KEGG   Bacillus glycinifermentans: BGLY_0747Help
Entry
BGLY_0747         CDS       T04537                                 

Definition
(GenBank) (R,R)-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BGLY_0747
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BGLY_0747
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BGLY_0747
    1.1.1.-  
     BGLY_0747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: SCA84570
UniProt: A0A1C3S9P8
Position
1:781130..782182
Genome map
AA seq 350 aa AA seqDB search
MKMKALRWHDAKDLRLEQIDEPQAAAGKVKVKVEWCGICGSDLHEYTAGPIFIPTETHLL
SGDKAPVVLGHEFSGQVVEVGEGVTNVKAGDRVTVEPIYACGECEACKQGMYNLCDKMGF
FGLAGGGGGFSEYAAVPAEMIHKLPDDVSFEQGALVEPSAVALHAVRQSKLKVGDKAAVF
GTGPIGLLVIEALKASGASEIYAVELSDIRRQKAAELGAIVIDPKQCDAVAEIQKRTNGG
VDVAYEVTGVPPVLKQAIHATKINGETMVVSIFEKEAPIHPHDIVMKERTLTGIIGYRDV
FPAVISLMAQGYFPADKLVTKRITLDEVIEEGFEGLLRERDQVKILVKAE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaagcgcttagatggcacgatgcgaaagacttgcgattggaacaaatcgac
gaaccccaggcggcagcgggcaaagtgaaagtcaaagtagaatggtgcgggatttgcgga
agcgatcttcacgaatataccgcaggccctattttcattccgactgaaacacacctgcta
agcggcgataaagccccggtcgttttgggacacgaattttcggggcaggtcgtggaagta
ggagagggggttacaaatgtcaaagccggcgatcgtgtaacggttgaaccgatctacgcg
tgcggcgaatgtgaagcttgcaaacaaggaatgtataatctgtgcgataaaatgggattc
ttcgggctcgccgggggaggcggcggattttccgagtatgcagccgtgccggcggaaatg
attcataaattgccggatgacgtatcatttgaacaaggtgcgcttgttgaaccgtcagcc
gttgcgcttcatgccgtccgtcaaagcaaattgaaagtcggcgacaaagcggccgttttt
gggacaggcccaatcggcttgctcgtgattgaagcattaaaagcgtccggcgcatcggaa
atctacgctgtcgaattatcagacatccgccgccaaaaagcagcagagcttggtgcaatc
gtcattgatccaaaacaatgcgacgcagtggccgaaatccaaaaacggacaaacggcggc
gtcgatgtagcctatgaagtgacaggcgtgccgcccgttttaaaacaggcgattcatgca
acaaaaatcaacggggaaacgatggtcgtcagcatttttgaaaaagaagcgccgatccat
cctcacgatatcgtcatgaaagaacgcacactaaccgggatcatcggataccgcgacgtg
tttcccgctgtcatcagtctgatggctcaagggtatttcccggctgacaaactggtcacg
aaacgaattacgcttgatgaagtcatcgaagagggcttcgaaggattgttgagagaaaga
gatcaagtgaaaatcctggtcaaagctgaataa

DBGET integrated database retrieval system