KEGG   Bacillus glycinifermentans: BGLY_0853Help
Entry
BGLY_0853         CDS       T04537                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00561  Glycerolipid metabolism
bgy00640  Propanoate metabolism
bgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BGLY_0853 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BGLY_0853 (gldA)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     BGLY_0853 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase TINF2_N
Motif
Other DBs
NCBI-ProteinID: SCA84676
UniProt: A0A1C3SA42
Position
1:900308..901411
Genome map
AA seq 367 aa AA seqDB search
MSNLVKSVTSPKKFITGKRLLENLNDYIKDFGDKAYIICDEFILERAQKEAGESIKKAGN
QAVFEKFNYECTQEEIDRNRELAREAGANIIVGIGGGKTLDTAKATAYYENLPVVIFPTI
ASTDAPCTALAVIYKHSGAFDRYLFLPTNPDVVLADSDILSAAPPRFFAAGIGDALATYF
EARACYRANGDNLVLMKPSTTGLGLARLCYDTLLENGVKAMQAVKNGISTRAVEDTIEAT
IYLSGVGAESGGLAAAHAIHNGMTAVPALHHAQHGEKVTFGLLAQLVLENVPTEELETVI
NFIKGVGLPLTLKDLGVEEFVEEEWRQVAQSACAEGDTMGNMPFPVTPDDVYNAIIAANA
IAESYHD
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatttagtgaagtcagtcacatcacctaaaaaatttatcacgggaaaacgattg
cttgagaacttgaacgattatattaaagattttggcgacaaggcttacatcatttgcgac
gaatttattttggaacgggcccaaaaagaagccggagaatctattaaaaaagcaggcaat
caagccgtttttgaaaaatttaattatgagtgtacacaggaagaaatcgatcgaaacagg
gagcttgcacgcgaagcgggcgcgaacatcatcgttgggatcgggggcggaaaaacgctt
gatacggcaaaagcgacagcatattatgaaaatctgccggtcgtgattttcccaaccatc
gcttcaacagatgctccttgtacggcgctggccgtcatctataaacatagcggagcattt
gaccgctatttatttttgccgacaaaccctgacgtcgttctcgctgactcagatatttta
tctgcagcgccgccgcgctttttcgccgccggaatcggtgacgcgctggcgacatacttt
gaagcgcgcgcatgctatcgcgccaacggggataacctcgtgctgatgaagccttcaaca
acgggcctcggccttgcccgcctttgctatgatacgctattggaaaacggcgtaaaagca
atgcaggctgtcaaaaacggaatttcgacgcgcgccgtggaagataccattgaagcgacg
atttatttgagcggagtcggcgcggaatcaggcggtcttgccgcagcccacgccatccac
aacggaatgacggccgtaccggcccttcatcatgctcagcacggcgaaaaagtcaccttc
ggccttctcgctcagctcgtccttgaaaacgtgccgacagaagaattggaaacggtcatc
aacttcatcaaaggcgtcggcctcccgctgacattaaaagaccttggagtcgaggaattc
gtcgaagaagaatggcgccaagtcgctcaaagcgcttgtgcggaaggcgacacaatgggc
aacatgccgttccctgtcacacctgacgacgtctacaacgccatcatcgccgccaacgcg
atcgcagagtcttatcacgattaa

DBGET integrated database retrieval system