KEGG   Bacillus glycinifermentans: BGLY_2683Help
Entry
BGLY_2683         CDS       T04537                                 

Gene name
ndk
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00230  Purine metabolism
bgy00240  Pyrimidine metabolism
bgy01100  Metabolic pathways
bgy01110  Biosynthesis of secondary metabolites
bgy01130  Biosynthesis of antibiotics
Module
bgy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bgy_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bgy_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BGLY_2683 (ndk)
   00240 Pyrimidine metabolism
    BGLY_2683 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bgy04131]
    BGLY_2683 (ndk)
Enzymes [BR:bgy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BGLY_2683 (ndk)
Membrane trafficking [BR:bgy04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BGLY_2683 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: SCA86506
UniProt: A0A1C3SFA3
Position
1:complement(2575945..2576391)
Genome map
AA seq 148 aa AA seqDB search
MEKTFVMVKPDGVQRQLIGDILSRFDRKGLQLIGAKLMKVSEETAGEHYKEHKEKPFFGE
LVDFITSGPVFAMVWKGEDAIAISRQLIGKTNPKEALPGTIRGDYGMSVGKNIIHGSDSP
ESAVREIGLFFKENELIEEEKLINQWIY
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacctttgtgatggttaaacccgatggcgttcagcgccaactgatcggcgac
attttgtctagatttgatcgaaagggcttacaattgatcggagccaaactgatgaaagtc
tcagaagagacggccggcgagcattataaagagcataaagaaaaaccgttttttggcgaa
cttgtcgattttattacgtcaggccctgtctttgcaatggtatggaaaggggaagacgca
attgcgatcagcaggcagctgatcggcaaaacgaaccccaaagaagcgctgcctggcaca
atccgcggggactacggcatgagcgtcggcaaaaacatcattcacggttcagattctcct
gaaagtgcagtgcgtgaaatcggcttattttttaaagagaatgaacttattgaagaagaa
aagttaatcaatcaatggatctattaa

DBGET integrated database retrieval system