KEGG   Bacillus glycinifermentans: BGLY_3448Help
Entry
BGLY_3448         CDS       T04537                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00020  Citrate cycle (TCA cycle)
bgy00480  Glutathione metabolism
bgy01100  Metabolic pathways
bgy01110  Biosynthesis of secondary metabolites
bgy01120  Microbial metabolism in diverse environments
bgy01130  Biosynthesis of antibiotics
bgy01200  Carbon metabolism
bgy01210  2-Oxocarboxylic acid metabolism
bgy01230  Biosynthesis of amino acids
Module
bgy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bgy_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BGLY_3448 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BGLY_3448 (icd)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     BGLY_3448 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: SCA87271
UniProt: A0A1C3SHB2
Position
1:complement(3321868..3323181)
Genome map
AA seq 437 aa AA seqDB search
MFFNIALHNMGGFIVAQGEKITVSGGVINVPNNPIIPFIEGDGTGPDIWRAASRVLEAAV
EKAYKGEKKITWKEVYAGEKAFNKTGEWLPEETLDTIREYLIAIKGPLTTPVGGGIRSLN
VALRQELDLFTCLRPVRYFKGVPSPVKRPEDTDMVIFRENTEDIYAGIEYAKGSDEVKKL
ISFLKDELGVNKIRFPETSGIGIKPVSEEGTSRLVRAAIEYAIEHGRKSVTLVHKGNIMK
FTEGAFKNWGYEVAEKEFGDKVFTWAEYDRIAEKDGKDAANKAQSEAEAAGKIIIKDSIA
DIFLQQILTRPAEFDVVATMNLNGDYISDALAAQVGGIGIAPGANINYETGHAIFEATHG
TAPKYAGLDKVNPSSVILSGVLLLEHLGWNEAADLVIQAMEKTIASKVVTYDFARLMDGA
TEVKCSEFGDELIKNMS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcaatattgcattacataacatgggaggttttattgtggcacaaggtgaaaaa
attacagtctctggcggagtaataaacgttccaaataacccgatcatcccgtttattgaa
ggagacggaaccggtcctgatatttggagagcggcttcaagggttttggaagcagccgtt
gaaaaagcatacaaaggcgaaaagaaaatcacttggaaagaagtctatgccggtgagaag
gcatttaacaaaacgggcgaatggcttccggaggaaacgcttgacacgatccgcgaatat
ctcatcgccatcaaaggtcctttaacgacaccggtagggggcggaatccgctcgttaaac
gttgcgctcagacaggagcttgacctgttcacatgcttacgtcctgtccgctatttcaaa
ggcgttccttctccggttaaacgccctgaagatacagacatggtcatcttccgcgaaaat
actgaagacatttacgcgggcattgaatacgccaaaggctccgatgaagtgaaaaaactg
atttccttcctgaaagacgagctcggcgtcaataaaatccgtttccctgaaacgtcaggc
atcggcatcaaaccggtttctgaagaaggaacatcaagacttgtcagagcggcaatcgag
tatgcgattgagcacggccgcaaatccgtgaccctcgttcacaaaggaaacatcatgaaa
ttcactgaaggtgcctttaaaaactggggatatgaagtggctgaaaaagaattcggcgat
aaagtatttacatgggccgaatatgaccgcattgccgaaaaagacggaaaagacgctgcc
aataaagcgcaaagcgaagctgaagcggctggaaaaatcatcattaaagacagcatcgcc
gacattttccttcagcagattctgacgcgtccggcagaatttgatgtcgtagcgacaatg
aacctaaacggggattatatttctgacgctcttgccgcccaagtcgggggaattgggatt
gcgcctggagcgaacatcaactatgaaacaggacatgccatttttgaagcgactcatggc
acggctcctaaatatgccggtcttgacaaggtcaacccatcctcagtcatcctttccggc
gtcctgcttcttgagcatttaggctggaatgaagccgcagatcttgtcattcaggcgatg
gaaaaaacgatcgcatcaaaagtcgtcacttacgactttgcccgtttgatggacggagcg
acagaagtgaaatgctctgagttcggagacgagctcattaaaaacatgtcttaa

DBGET integrated database retrieval system