KEGG   Bacillus glycinifermentans: BGLY_4093Help
Entry
BGLY_4093         CDS       T04537                                 

Gene name
pdxA
Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
bgy  Bacillus glycinifermentans
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BGLY_4093 (pdxA)
Enzymes [BR:bgy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     BGLY_4093 (pdxA)
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     BGLY_4093 (pdxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: SCA87916
UniProt: A0A1C3SJL5
Position
1:complement(3943312..3944310)
Genome map
AA seq 332 aa AA seqDB search
MEKPVIGITMGDAAGVGPEIIAKALKSRKVYDMCKPLVIGDMKMLKKAAVQIGSEVVINK
VMHPDECGFVHGKIDCLDIDLLPENLPVGKVSAEAGNAAFHFVKKAVELAQESCIQAICT
APLNKEALHKGGHRYPGHTEILAHLTNTTDYSMMLASPKLKVIHLTTHQGLIKAIQSITP
ERTYKVIRLAHDTLTRAGFQRPKIAVCGINPHAGENGLFGSGEEERQLLPGIEQAAAEGI
DAGGPYPADTLFYKAVRGDVDLVVACYHDQGHIPVKVLGLEEGVNITVGLNGGIIRTSVD
HGTAFDIAGQNKADERSMLAALRSAAELAPKS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaccggttatcggcattacaatgggcgacgcggcaggcgtcggtccggaaatt
atcgcaaaagctctcaaatcccgcaaagtgtatgacatgtgcaagccgctcgtcatcggc
gatatgaaaatgctgaaaaaagccgccgtccaaatcggatcagaggttgtcattaacaag
gtgatgcatccggacgagtgcggttttgtacatggaaagatcgattgtctcgatatcgat
ctgctgcctgaaaacctgccagttggaaaggtatcggctgaagccggaaacgccgctttt
catttcgtgaaaaaagcggttgaactcgctcaagaaagctgtattcaagcgatttgcaca
gcaccgttaaataaggaggcgctgcataaaggcggacaccgatacccggggcatacggaa
attctcgctcatttaacaaatacaaccgactacagcatgatgctagcttcgccaaaactg
aaggtgattcatctgacaacgcatcaagggctgattaaggcgattcagtcgattacgccg
gagcggacctataaagtcatccgtctcgcacatgatacattgacaagagccggattccaa
cggccgaaaattgcggtttgcggaatcaaccctcatgcaggggaaaacgggctgttcgga
agcggcgaagaagaacggcaattgcttccggggattgagcaggcggcagccgagggaatc
gatgccggcggcccataccccgcagacacgctgttttacaaggctgttcggggagatgtt
gaccttgtcgtagcctgctaccatgatcaggggcatattccggtcaaagtcctcgggctg
gaagagggcgtcaacattacggtcggattaaacggcgggatcattcgcacctctgtcgac
cacggaaccgcatttgacattgcggggcagaacaaagccgatgaaagaagcatgctcgct
gctttgcggtcagccgctgagcttgcgcccaaatcgtag

DBGET integrated database retrieval system