KEGG   Bacillus glycinifermentans: BGLY_4373Help
Entry
BGLY_4373         CDS       T04537                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bgy  Bacillus glycinifermentans
Pathway
bgy00071  Fatty acid degradation
bgy00072  Synthesis and degradation of ketone bodies
bgy00280  Valine, leucine and isoleucine degradation
bgy00310  Lysine degradation
bgy00362  Benzoate degradation
bgy00380  Tryptophan metabolism
bgy00620  Pyruvate metabolism
bgy00630  Glyoxylate and dicarboxylate metabolism
bgy00640  Propanoate metabolism
bgy00650  Butanoate metabolism
bgy00900  Terpenoid backbone biosynthesis
bgy01100  Metabolic pathways
bgy01110  Biosynthesis of secondary metabolites
bgy01120  Microbial metabolism in diverse environments
bgy01130  Biosynthesis of antibiotics
bgy01200  Carbon metabolism
bgy01212  Fatty acid metabolism
bgy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BGLY_4373 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BGLY_4373 (mmgA)
   00640 Propanoate metabolism
    BGLY_4373 (mmgA)
   00650 Butanoate metabolism
    BGLY_4373 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BGLY_4373 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BGLY_4373 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BGLY_4373 (mmgA)
   00310 Lysine degradation
    BGLY_4373 (mmgA)
   00380 Tryptophan metabolism
    BGLY_4373 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BGLY_4373 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BGLY_4373 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BGLY_4373 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bgy04147]
    BGLY_4373 (mmgA)
Enzymes [BR:bgy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BGLY_4373 (mmgA)
Exosome [BR:bgy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BGLY_4373 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III SpoVAD
Motif
Other DBs
NCBI-ProteinID: SCA88196
UniProt: A0A1C3SK94
Position
1:complement(4225287..4226468)
Genome map
AA seq 393 aa AA seqDB search
MMVRTVIIDGARTPFGKLGGSLQPKTASELGGIAIREALKRSGVRPEDVDEVIMGTVLQG
GQGQLPSRQAARHAGLPWDVKTETVNKVCASGLRSVTMADQIIRAGDADVIVAGGMESMS
NAPYALTKARWGLRMGDGSVKDLMILDGLTCSFTGVHMGSYGNSAARELEITREEQDRWA
LRSHMRAVRAAASGALGEEIVPVNIREKRGGELTVKHDESPRSDTSIERLAALAPVFDRD
GTITAGNAPGVNDGACAFTVMSDEKAKSLNLKPYAVMTAHASIAVEAKDFPKTPGLVINE
LLKKTGAELSDISLFEINEAFAAVALASGQIAGLDMEKVNVNGGAIALGHPIGASGARIL
LTLMYELKRRGGGTGIAAICSGGGQGDAVMIQV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcagaacggttattatcgatggagcgcgcacgcctttcggaaaactgggcgga
tcacttcagccaaaaacggcgtcagaactcggaggcattgccatcagagaagcgctgaaa
cggtcaggtgtcaggcctgaggatgtagatgaagttattatggggaccgttctgcaaggg
ggccagggacagctgccgtcaaggcaggcggcaaggcatgccggtcttccgtgggacgtt
aaaacggaaacggtcaataaagtatgcgcatcaggcttaagaagcgtgacaatggcggat
cagatcatccgcgccggcgatgccgacgtcattgtcgcaggcgggatggagtcgatgtca
aatgcgccttatgcgctgacaaaagcgagatggggcctgaggatgggagacgggtctgtt
aaggacttgatgatccttgacggattgacctgctcatttacgggggtgcatatgggctca
tatggaaattctgcggcaagagaattagagattacgagagaggagcaggaccgctgggcg
ctgcggagccatatgcgggcggttcgggccgccgcctcaggcgccctcggagaagagatc
gttcccgtcaacattcgcgaaaagcggggcggagagctgacggtgaaacatgatgaatcc
ccgcgcagcgacacatcgatcgaacggctggccgcgctggcgcccgtctttgaccgcgac
ggcacgattacggcgggcaatgccccgggcgtaaatgacggggcgtgtgcattcaccgtc
atgagcgatgaaaaggcaaagtctttgaatctgaagccttatgccgtcatgacggcgcat
gcttccatcgcagttgaagcaaaagactttccgaaaacacccgggcttgtcatcaatgag
ctgctgaaaaaaacgggggcggagctttcggatatcagcctgtttgaaatcaatgaggct
tttgcggcggtcgctctggcaagcggacaaatcgcagggctcgatatggaaaaggttaat
gtcaacggcggcgcgattgcgcttggccatccgatcggcgccagcggggcaaggatcctt
ttgacgcttatgtacgaattaaaacggcgcggcggcggtacgggaattgccgcgatttgc
agcggcggcggacagggagatgccgtcatgatccaagtttaa

DBGET integrated database retrieval system