KEGG   Bradyrhizobium guangzhouense: XH91_09110Help
Entry
XH91_09110        CDS       T06161                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanine--D-glutamate ligase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
bgz  Bradyrhizobium guangzhouense
Pathway
bgz00471  D-Glutamine and D-glutamate metabolism
bgz00550  Peptidoglycan biosynthesis
bgz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    XH91_09110
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    XH91_09110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bgz01011]
    XH91_09110
Enzymes [BR:bgz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     XH91_09110
Peptidoglycan biosynthesis and degradation proteins [BR:bgz01011]
 Precursor biosynthesis
  Amino acid ligase
   XH91_09110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C IlvN AdoHcyase_NAD ADH_zinc_N adh_short UDPG_MGDP_dh_N DUF3583
Motif
Other DBs
NCBI-ProteinID: QAU45501
Position
1880551..1881948
Genome map
AA seq 465 aa AA seqDB search
MIPVTSFAGKTVAVFGLGGSGLASCDALKAGGAEVIAADDNAENVAKAAQAGFITADLRT
VSWDSFAALVLAPGVPLTHPVPHWSVLKAREAGVEVIGDIELFCRERRRHAPNAPFVAIT
GTNGKSTTTALIAHLTKVAGYDTQMGGNIGTAILSLEPPRTGRVHVIEMSSYQIDLTPSL
DPSVGILLNVSEDHIDRHGTIEHYAEVKERLVANVQAGGTSIVGVDDGYCRDIADRLDRA
GRNVVRISVKNPLASGIHVEHGTIVRTSGGARSEIATLGGIGSLRGLHNAQNAACAAAAA
LAMGISLDVLQNGLRSFPGLAHRMEQVGRRGNVLFVNDSKGTNADATAHALSSFSEIFWI
AGGKPKAGGITSLTGFFPRIRKAYLIGEAAQEFSSTLGSVAHEISQTLDVAVEQAARDAE
ASGLTDAVVLLSPACASFDQYRNFEIRGTKFRELVQALPGVKPVV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgatcccggtcacatcctttgccggcaagacggtcgcggtgttcggcctcggcggctcg
gggctcgcctcctgcgatgcgctgaaggccggcggcgccgaggtcattgccgccgacgac
aatgccgagaacgtcgccaaggccgcgcaggccggtttcatcaccgcggatctgcgaacc
gtttcgtgggacagttttgctgcgctggtgctggcgcccggcgtgccgctgactcatccg
gtgccgcattggagcgtgctgaaggcacgcgaggccggcgtcgaggtgatcggcgacatc
gagctgttctgccgcgagcgccgccgccacgcgccgaacgcgccgttcgtcgccatcacc
ggcaccaacggcaagtcgaccacgacggcgttgatcgcccatctcacgaaggtcgccggc
tacgacacccagatgggcggtaatatcggcaccgcgatcctgtcgctggagccgccgcgc
acgggccgcgtccacgtcatcgagatgtcgtcctatcagatcgacctcacgccctcgctc
gatccctccgtcggcattctgctcaatgtcagcgaggatcacatcgatcgtcacggcacg
atcgagcattacgccgaagtgaaggagcgcctggttgcgaacgtgcaggcaggcggaacc
tcgatcgtcggcgtcgatgacggctattgccgcgacatcgccgaccggctcgatcgcgcc
ggcaggaatgtggtgcggatctccgtcaagaatccgctcgcgagcggcatccatgtcgag
cacggcaccatcgttcgcacctccggcggcgcccgcagcgagatcgccacgcttggcggc
atcggctcgctgcgcgggctgcacaatgcgcagaacgcggcctgcgcggcggcagccgcg
ctcgcgatgggcatcagcctcgatgtgcttcagaacggcctgcgcagctttcccggcctg
gcacatcgcatggaacaggtcggccgccgcggcaatgtgctgttcgtcaacgactccaag
ggcaccaacgccgacgccaccgcgcatgcgctatcgtcattttcggaaatcttctggatc
gccggcggcaagccgaaggcgggcggcatcaccagcctgaccggtttcttcccgcgcatc
cgcaaggcttatctgatcggcgaggccgcgcaggagttttccagcacgctcggctcggtg
gcgcatgagatcagccagacgctcgacgtcgccgtcgagcaggccgcgcgcgacgcggag
gcatcgggcctcacggatgcggtcgtgctgctgtcgccggcctgtgcctcgttcgaccag
taccgcaatttcgaaatccgcggcacaaagttccgcgagctggtgcaggcgctgccgggt
gtgaagccggtggtgtga

DBGET integrated database retrieval system