KEGG   Bradyrhizobium guangzhouense: XH91_18150Help
Entry
XH91_18150        CDS       T06161                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bgz  Bradyrhizobium guangzhouense
Pathway
bgz00450  Selenocompound metabolism
bgz00970  Aminoacyl-tRNA biosynthesis
bgz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bgz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    XH91_18150
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    XH91_18150
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bgz01007]
    XH91_18150
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bgz03016]
    XH91_18150
Enzymes [BR:bgz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     XH91_18150
Amino acid related enzymes [BR:bgz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   XH91_18150
Transfer RNA biogenesis [BR:bgz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    XH91_18150
 Prokaryotic type
   Other AARSs
    XH91_18150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: QAU47088
Position
3743697..3745616
Genome map
AA seq 639 aa AA seqDB search
MATRAKKAAKGKRSKKAAKKVAKKAVKALARKAAKKVKKTKKAVAKKGVKKSAAKTVKKA
SKKAAKKPAKAPAKNAVKKAKKAEATVIAAPAPVVAPPKAVKPKPSKPRAPKPVAAPKTD
VPAAARGDNVFYISTAIAYPNGSPHIGHAYEAISADVLARFARLDGKDVFFLTGTDEHGQ
KMVQTAQNEGLSPSALATRNANRFKEMDQRLNVSFDRFIRTTEEQHHRSSQEIWRRMEAN
GDIYADTYSGWYSVRDEAYYAEDETRLNDDGVRLGPQGTPVEWVEEKSYFFRLSTYQDKL
LKLYADHPEFIGPDSRKNEVVSFVRGGLRDLSISRTTFDWGVKVPSDDEHVMYVWVDALT
NYITGVGFPDESDKNWRYWPADVHIIGKDIIRFHAVYWPAFLMSAGLALPKRVYAHGFLF
NRGEKMSKSVGNVVDPFNLADQYGVDQMRYFFLREVSYGQDGNYNHEAIVARINADLAND
LGNLAQRSLSMIAKQLGGVLPEPGAFSDNDKAILAMADAMIGASREAMATQQIHQWLNAV
WAVVAEANRYFAGEAPWALAKTDPVRQKTVLYVTAEVVRQIAILAQPAMPTASGLLLDSL
GIPAAERNFAMLGGEKRIAPGAALPAPTPAFPRYVEPAA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
gtggcaacacgagctaagaaagccgccaagggcaagcgcagcaagaaggctgcaaagaag
gtcgccaagaaggccgtgaaggcgctggcgcgtaaggctgccaagaaggtcaagaagacc
aagaaggctgtcgccaagaagggcgtgaagaagagcgctgcgaagacggtaaagaaggcc
agcaagaaggcggcgaagaagccagccaaggctcctgcaaagaacgcggtcaagaaggcg
aagaaggctgaggccaccgtgatcgccgcgccggctcctgtcgtcgcgccgccaaaggcc
gtcaagcccaaaccgtcaaaacccagagcgccgaagccggtggccgcgccgaaaacggat
gtgcccgcggccgcacgtggcgacaatgtcttctacatctcgaccgccatcgcctatccc
aacggcagcccgcatatcggtcacgcctatgaggcgatctcggccgacgtgctggcgcgc
ttcgcccggctcgacggcaaggacgtgttctttctgacgggcacggacgagcacggccag
aagatggttcagaccgcgcagaacgagggcctgtcgccgtcggcgctcgcgacccgcaat
gccaaccgcttcaaggagatggaccagcgcctgaacgtctcgttcgatcgcttcattcgc
accaccgaagagcagcatcatcgctcgagccaggagatctggcggcgcatggaagcgaat
ggcgacatctacgccgacacttattcgggctggtattcggtgcgtgatgaggcctattac
gccgaagacgagacacgtctgaacgatgatggcgtccgcctcggtccgcagggcacgccg
gtcgaatgggtcgaggagaagagctatttcttccgcctgtcgacctaccaggacaagctg
ctgaagctctacgcagaccatcccgaatttatcggcccggactcgcgcaagaacgaggtg
gtgagcttcgtgagaggcggcctgcgcgatctctcgatctcgcgcaccaccttcgattgg
ggtgtaaaagtgcccagcgacgatgagcatgtgatgtatgtctgggtcgacgcgctgacc
aactacatcaccggcgtcggcttccccgacgaaagcgacaagaactggcgctactggccg
gccgacgtgcatatcatcggcaaggacatcatccgcttccacgccgtgtactggccggca
ttcctgatgtcggcgggccttgcgctgccaaaacgggtctatgcccacggtttcctgttc
aacaggggtgagaagatgtcgaagtcggtcggcaacgtcgtcgaccccttcaatctcgcc
gaccagtacggcgtcgaccagatgcgctatttcttcctgcgtgaggtctcctacggccag
gacggcaactacaaccatgaagccatcgtcgcgcgcatcaatgccgatctcgccaacgat
ctcggcaacctcgcgcagcgctcgctgtcgatgatcgccaagcagctgggcggcgtgctg
ccggagcccggcgcgttcagcgacaacgacaaagcgatcctggcgatggccgacgccatg
attggcgcgtcgcgcgaagccatggcgacgcagcagatccatcaatggctcaatgccgtg
tgggcggtggtcgcggaagccaatcgctatttcgcgggagaggcgccatgggcgctcgcc
aagaccgatcctgtccggcagaagacggtgctctatgtcaccgccgaagtcgtgcgccag
atcgcgatcctggcccagccggcgatgccgaccgcatcagggctgctgctcgatagcctc
ggcatcccggcagctgagcgcaatttcgcgatgctcggcggcgagaagcggatcgcacct
ggcgcggcgctgccagcgccgacgccggcgttcccgcgctacgtcgagccggcggcctaa

DBGET integrated database retrieval system