KEGG   Halalkalibacterium halodurans: BH3551
Entry
BH3551            CDS       T00039                                 
Name
(GenBank) integrase (phage-related protein)
Organism
bha  Halalkalibacterium halodurans
SSDB
Motif
Pfam: Phage_integrase Arm-DNA-bind_4 Phage_int_SAM_5 HAD_2
Other DBs
NCBI-ProteinID: BAB07270
UniProt: Q9K722
Position
3650986..3652122
AA seq 378 aa
MASIQKMKNGRWRYRVSYKENGKYKTKTKGGFRTKKEAELAAAELEGQLHKGYDINAGDQ
LFSEYMRNWYEVFRKGKKSEDNDNDIRRAVEFVEKYLPDVKLKDLTREMYQKALNEYGET
HSTASVKKHHTYMRACLKEALADGIIYKDPTFNVVAVGKVEPKNEEIKYLNYEEAAKLLR
VTFGNLQQRYISRYIILFALATGARFSEIIGLTWDCVDFENKTVTINKTWDHKYKKWFDN
TKNYASKRTITVDDHTLSILKDLKRKQAQLAIKTGLRNEHNLVFINSKFELVTNNAVNKT
LRLLCKKANIKEITCHGLRHTHASMLLFKGVNIKYVSRRLGHKDIVTTLQTYSHIMDEME
QKESRQVDATMTELYNAR
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggccagtattcaaaagatgaaaaatggtcgttggcgttatcgtgtttcatacaaggaa
aacgggaaatacaaaacgaaaacgaaagggggttttcgcaccaaaaaagaggctgaactt
gcagccgctgaattggaggggcaacttcacaaaggatacgacatcaatgccggtgatcag
cttttttcagagtatatgcgaaattggtatgaagtttttcgtaaaggaaagaaaagtgaa
gataatgacaacgacattcgacgcgctgtagagtttgtagaaaaatatctcccagacgtg
aagctgaaggatttgacgcgggagatgtatcaaaaggcgctaaatgagtatggtgaaacc
cactccacagcatccgttaagaagcatcacacctatatgcgagcatgcctaaaagaagcg
ctggctgacgggattatttataaagacccgacttttaatgtggtggctgtcggaaaagta
gaaccgaagaacgaggaaatcaaatacttgaactacgaggaagcggccaaactgttgagg
gtaacgttcggtaatttacagcaacgatatatttctcgatacatcattttgtttgcactg
gccaccggcgctcgtttttcggagattatcggtctcacttgggattgtgtagattttgaa
aacaagacggtcacaatcaacaaaacgtgggaccacaagtataaaaaatggttcgataac
acaaagaactatgcttcgaaacggacaatcacagtcgacgatcatacattaagcattttg
aaagatttgaaacgaaagcaagcacagctcgcaatcaaaacgggactgcggaatgaacac
aatctcgttttcatcaatagcaaatttgaactggtaaccaataacgcagtcaataaaaca
cttcgtttgctgtgcaaaaaggcaaatatcaaggaaatcacatgccacggactccggcat
actcatgcttcgatgcttctattcaaaggagtgaacatcaagtatgtttctcggcggctc
gggcataaagatatcgtaaccaccctccagacatactcgcacattatggatgaaatggaa
caaaaagagtcacgccaagtagacgcgaccatgacagagctctataatgcccgataa

DBGET integrated database retrieval system