KEGG   Bacillus halodurans: BH0285Help
Entry
BH0285            CDS       T00039                                 

Definition
(GenBank) BH0285; unknown conserved protein in others
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bha  Bacillus halodurans
Pathway
bha00010  Glycolysis / Gluconeogenesis
bha00260  Glycine, serine and threonine metabolism
bha00680  Methane metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
bha01230  Biosynthesis of amino acids
Module
bha_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bha_M00002  Glycolysis, core module involving three-carbon compounds
bha_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BH0285
  Energy metabolism
   00680 Methane metabolism
    BH0285
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH0285
Enzymes [BR:bha01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BH0285
Membrane trafficking [BR:bha04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BH0285
Exosome [BR:bha04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BH0285
  Exosomal proteins of melanoma cells
   BH0285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF2025
Motif
Other DBs
NCBI-ProteinID: BAB04004
UniProt: Q9KG30
Position
complement(307327..307866)
Genome map
AA seq 179 aa AA seqDB search
MKSIYVIRHCEAEGQPPESPLTNKGLKQAIDLAAFFDNIKVERIISSPYKRAIQTIQPLA
KKLNVEIEINSQLTERVLSTNHLSDWFEKLRTTFEDFEIKFEGGESSQDAVKRILNVVED
SFTGEFENTLIVTHGNLMSLLLNHYNKEFGFDEWLNLSNPDVYLLKIDNNEITSERLWS
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagcatttatgttattaggcattgtgaagctgaggggcagccacctgaatcacca
ctcacgaacaaaggtttaaaacaagccattgatttagctgctttttttgacaatattaaa
gttgaacgtatcatttcaagtccatataagcgtgctattcaaacgatacaaccacttgca
aagaagttaaatgttgagatagaaattaatagccaattaacagaacgtgtgctaagcacc
aaccatctttccgattggtttgaaaaattacgaacaacatttgaggattttgaaataaaa
ttcgaaggtggagaatccagccaagacgcagtaaaacgaatattaaatgttgtggaggat
tcttttacaggcgaatttgaaaatacattaattgtgacacatggaaatttaatgtctttg
ttattaaaccactataataaggaatttggttttgatgaatggttaaatcttagtaatcct
gacgtatatcttttgaaaatagataacaatgaaataacttcagaacgattatggagctaa

DBGET integrated database retrieval system