KEGG   Bacillus halodurans: BH1316
Entry
BH1316            CDS       T00039                                 

Definition
(GenBank) Na+/H+ antiporter
  KO
K05568  multicomponent Na+:H+ antiporter subunit D
Organism
bha  Bacillus halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bha02000]
    BH1316
Transporters [BR:bha02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BH1316
SSDB
Motif
Pfam: Proton_antipo_M NADHdeh_related
Other DBs
NCBI-ProteinID: BAB05035
UniProt: Q9KD98
Position
complement(1403815..1405296)
AA seq 493 aa
MSNLVILPILLPFIVGSFLILFAKHHGIQRFLTAITMVGLLLFSFYLATLVYQEGIYTLQ
LGNWPAPFGIVLVADMFATMMIILSSIVGVACLFFAFQTISSERERYYFYPFYLFLIAGV
NGAFLTGDLFNLFVFFEVMLIASYALIVLGGTKYQLRESFKYVVINVFASILFIVGVAYL
YSVTGTLNFADLAIRVAELEQQGVLNVIAILFLVVFGMKGALFPLYFWLPRSYYGPPAAI
AALFGGLLTKVGIYAIIRTFTLIFNHDPSFTHTIILALAGFTMFFGVLGAVSQFDFKRIL
SYHIISQVGYMVMGLGIFTPLALAGAIYYIAHHIIVKAALFLFAGATEKITGTTELKKMG
GLLKTHPWLAWLFFISAISLAGIPPLSGFFSKFALILAGFEEGRYVIVTVALIVGLLTLF
SMMKIFIYAFWGEQKHTEQQAKMPIGKLLLPIAPLVVLTIVLGFGAEPIFQYSLQVADEL
LNPSVYIESVLKE
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgagtaacttagtcattctaccaattttattaccgtttatcgttggttcctttctcatt
ttgtttgcaaagcatcacgggattcaacgatttcttacagcaataacgatggttggcctg
ctgctgttttccttttatttagcaacccttgtttaccaagaaggaatctatacacttcag
cttggaaattggccagccccgttcggaattgtgctcgtcgctgatatgtttgcgacgatg
atgatcattctttcgagcattgttggcgtcgcatgtttattttttgcctttcagactatt
tcatctgaaagagaacgctattacttttatccgttttacttgtttttaattgcgggagtg
aatggggcgtttcttactggcgatctctttaacttattcgtctttttcgaagtgatgctc
atcgcttcctatgcgttgattgttttgggaggcacgaagtatcagttacgtgagtctttc
aaatatgtcgtgattaatgtttttgcttccattttgtttatcgtaggtgtcgcctatctc
tattcagtcacagggacactgaactttgcggacttagctattcgcgtggcagagctagag
caacaaggggtgctcaatgtgatcgcgattttgttcttggtcgtattcgggatgaagggt
gctttattccctctctatttctggcttccaagatcctattatggaccacctgctgcaatt
gccgccttgttcggtggcttgctaacaaaggttggaatttacgcgattatcaggacattt
acacttatttttaaccatgacccgagctttacgcatacgataattctcgctttggctgga
ttcacgatgtttttcggtgtcttgggagcagtatcgcaatttgactttaagcgtatcctc
tcctaccacatcattagtcaggtcggttacatggtcatggggctcgggatttttactccc
cttgcccttgcaggtgcgatttattatatcgcccaccatattattgtaaaagcagccctc
ttcttatttgcaggggcaacagaaaaaatcacagggacgacggaattgaaaaagatgggc
ggccttttaaagacccacccatggcttgcatggttgttctttatttcagccatttcactt
gcaggaattcctccactaagcggcttcttcagtaaattcgctctgattcttgcaggcttt
gaagaaggtcgatatgtgatcgtaactgtcgcgctcatcgtcggtttgctcacccttttc
tcgatgatgaagattttcatttatgcgttttggggcgagcaaaagcatacagagcagcaa
gcaaaaatgccaattggaaaacttttgctaccgatcgctcctctcgtcgtgctaacgatc
gtcttagggttcggagcagaaccaatcttccaatactcgctgcaagtggccgacgagcta
ttaaatccatccgtctacatcgaatctgtgcttaaggagtag

DBGET integrated database retrieval system