KEGG   Bacillus halodurans: BH1319
Entry
BH1319            CDS       T00039                                 

Definition
(GenBank) Na+/H+ antiporter
  KO
K05565  multicomponent Na+:H+ antiporter subunit A
Organism
bha  Bacillus halodurans
Brite
KEGG Orthology (KO) [BR:bha00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bha02000]
    BH1319
Transporters [BR:bha02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BH1319
SSDB
Motif
Pfam: Proton_antipo_M DUF4040 Proton_antipo_N
Other DBs
NCBI-ProteinID: BAB05038
UniProt: Q7AJV8
Position
complement(1406064..1408478)
AA seq 804 aa
MTLLHWATVSPFLLAIFIPILYKYTRSIHTGWFVLVLPLVLFGYFLSLLPITSNGGVIHE
TIPWVPSLGINFTVYVDGLSLLFALLITGIGTLVALYSIYYLSKKTEKLNNFYVYLLMFM
GAMLGVVLSDNLIVLYVFWELTSLASSLLISYWFHREKSTYGAQKSMLITVFGGFAMLGG
FSLLYVITGTFSIREIIEQADAVLASTLFLPAMLLVLLGAFTKSAQFPFHIWLPDAMEAP
TPVSAYLHSATMVKAGLYLVARLTPVFGGTPEWFWLLAGFGIITLCWGSISAVRQKDLKS
ILAFSTISQLGLIMCLFGLGSATLHFDPTDSMIKFYATATLAAVFHLINHATFKGSLFMT
VGIIDHETGTRDIRKLGGLMAIMPVTFTVSLIGLAAMAGLPPFNGFLSKEMFFSGVVTAT
TLGIFNMETWGFLFPVLAWVASVFTFVYCAIMFFRTFTGEFKKENYDVHVHEAPMGMLIS
PVILGSLVVIFGLFPNLLTYTIIEPAVTAILGADVFGGGEANIYLWHGFNPELFMTIAVV
AFGTLIFMNMKKWQQTAFYLRERDPLNRVYDSSLDWLIKGSQGITRVQMTGMLRDYFAYM
CVFMILLFGYTMVRYNAFAIDTVNVSVISPYMWVLTLVFIGSTLAIPFINHRITAIIVVG
VIGFLLALFFVIFRAPDLALTQLLVETVTVVLFMLAFYHLPELRKEKFTPRFNLVNLFIS
IGVGGLVTLIALSSFALGTEAGLGTISEYFIENSKELAGGYNMVNVILVDFRGLDTLLEV
LVLGIAALGVIAMIKLRMTGREDV
NT seq 2415 nt   +upstreamnt  +downstreamnt
ttgacgcttttgcattgggctacagtttcaccttttttacttgcgatcttcattcctatt
ttgtataaatacacaagatccatacatacgggatggtttgtgctcgtccttccgctcgtg
ctgtttggctatttcttatcgttattaccaataacctcgaacggaggcgtaatccacgag
accattccttgggttccttcacttggaatcaactttactgtctatgttgacggactcagt
ttattgtttgctcttttaatcactgggattggtactcttgtcgccctttactctatctac
tatttgtcgaaaaagaccgaaaaactgaacaacttctatgtttatttacttatgtttatg
ggcgccatgctcggagtcgtcctctccgataacttgatcgttctttacgtattttgggag
ctcacaagtttagcctcatccctattaattagttattggttccatcgtgaaaaatcaacg
tacggtgcccagaaatcgatgctcattaccgtttttggtggctttgccatgctcgggggg
ttttcactcctctacgtcattacgggcacgtttagcatccgagagatcattgagcaagca
gatgctgttcttgctagtacgttgtttttgccagccatgcttcttgttcttcttggagct
tttacaaaatctgcacaatttccattccacatttggcttccggatgcaatggaagcaccg
acgccagtcagtgcttacctccactccgcaacaatggttaaagcagggctctaccttgta
gctcgcttaacacctgttttcggcggaacgccagagtggttttggttacttgcaggattt
gggatcattacattgtgctggggatccatctcagccgttcgtcaaaaagaccttaaatcc
attttggccttctcaaccattagccagcttgggttaattatgtgcttgttcggtctaggg
tcagctactctccattttgaccctactgacagcatgataaagttttatgcaaccgccact
ttggcagccgtttttcatttaattaaccatgctacttttaaaggaagcttgtttatgacg
gttggaatcattgatcatgaaaccggtactagggatattcgtaaactcggcggattaatg
gccatcatgcctgtgacctttactgtttcattaattggactcgccgctatggctggatta
ccaccgttcaatgggttccttagtaaggaaatgtttttctctggagtcgtaactgccact
acgttaggaatttttaatatggaaacgtggggattcctattccctgttcttgcgtgggtt
gcaagtgtttttacattcgtctactgtgcaatcatgtttttccgcacatttacaggggag
tttaagaaggaaaattacgacgtacatgtccatgaagcaccaatgggaatgctgatcagt
ccagtcatccttggttctctcgtcgttattttcggattgttccctaacttgctaacttac
acgattatagagccagccgttactgccattttaggagcagatgttttcggcggaggagag
gcgaacatttatctttggcatgggtttaaccctgagctctttatgacgatcgctgtcgtt
gcttttggaaccttgatttttatgaacatgaaaaaatggcagcaaacagccttttactta
agagagcgcgatccattaaaccgagtgtacgacagctccctcgattggttaattaaaggt
tctcaaggaattacacgagtgcaaatgacagggatgctacgcgattattttgcgtacatg
tgtgtctttatgattttgctgtttggctatacgatggttcgctataatgccttcgctatt
gacacggtaaatgtctctgttatttcaccttatatgtgggtattaacactcgttttcatc
gggtcaacccttgcaattccttttattaatcatcgcattacagcgattattgtcgtcggt
gtcatcggatttctccttgccttgttctttgttatattccgagctccagacttggcactt
acgcagttacttgtagagaccgtgacagttgttctcttcatgctggccttttatcacttg
ccagagctacgaaaagagaagttcacaccgcgtttcaatctcgtcaacctctttatttcc
atcggtgttggtgggcttgtcacgttgattgctttaagctctttcgcattgggcacagaa
gcaggcttgggaaccatttctgagtacttcatcgaaaactcaaaggagcttgcaggtgga
tacaacatggtcaatgtcatccttgttgatttccgtggactcgatacacttcttgaggta
ctcgtacttggaatcgcagcacttggtgtcattgcgatgattaaattacggatgactggg
agggaggatgtatga

DBGET integrated database retrieval system