KEGG   Bacillus halodurans: BH1621Help
Entry
BH1621            CDS       T00039                                 

Gene name
ddlA
Definition
(GenBank) D-alanyl-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
bha  Bacillus halodurans
Pathway
bha00473  D-Alanine metabolism
bha00550  Peptidoglycan biosynthesis
bha01100  Metabolic pathways
bha01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BH1621 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BH1621 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BH1621 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bha01011]
    BH1621 (ddlA)
Enzymes [BR:bha01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BH1621 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:bha01011]
 Precursor biosynthesis
  Amino acid ligase
   BH1621 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 CPSase_L_D2 GARS_A ATP-grasp_4 ATP-grasp RimK TrkA_N ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: BAB05340
UniProt: Q9KCF0
Position
1694314..1695231
Genome map
AA seq 305 aa AA seqDB search
MKIAVLYGGTSAEREVSLSSGKGIMEALKANGHEVIGIDFHPDQVRDLVDLDVDLVFIGL
HGRLGEDGKVQALLDLLNIPYVGTGVQGSALAMDKAKAKLFFEKAGIRVAEEVVLHSFTY
DANAFNFTGTYPVVVKPNQEGSTIGLTVAETEEELLQGIEEAFRHDDTILIEEFIAGTEV
TVAVLGNKGEERSLPVVEIVPKNKLYDYESKYAPGMSEHIVPARISEEHTAYVQQAAVRA
HQALGCDVYSRVDFIVPNDGSDPVILKVNTLPGMTPTSLYPDAAKGVGMSYEEMIQTFVN
LSLKK
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatagcggttttatatggtgggacatcagcagaacgagaagtatcattatcatca
ggaaaagggattatggaggcgttaaaggcgaacggtcatgaggtcattggcattgatttt
catccagatcaggttcgcgacttggttgacttagacgttgaccttgtatttattggactt
cacggacggttaggcgaagatggaaaggttcaagcactgcttgacttgttaaacatccct
tatgttggtacaggtgttcaaggttcggcccttgccatggataaagcgaaggctaagctc
ttttttgaaaaagcaggcattcgggttgcagaggaggtcgtactccattcatttacgtac
gatgcaaatgcgtttaactttacaggcacatatcctgtcgtcgttaaaccaaatcaggaa
ggatcaaccatcggcttaaccgtagcagaaacagaggaggagcttttgcaagggattgaa
gaagctttccgtcatgatgatacaattctcattgaagagtttatcgccggaacagaagtt
acggttgctgtgcttggcaataaaggggaagagcggtcacttcctgttgtggaaattgtt
ccgaaaaataaactttatgattatgagtcaaaatacgctccagggatgagcgaacatatt
gttcctgcccgaatttctgaggagcataccgcttatgtgcaacaagcagccgttcgtgct
caccaagcgctagggtgtgatgtatattcgcgggttgattttatcgttccaaacgacgga
tcggatccggtcattttaaaagtcaatacgcttccggggatgacaccaacgagtttgtat
ccagatgctgccaaaggggttggtatgtcctatgaggaaatgatccaaacgtttgtcaac
ctttcgttaaaaaaataa

DBGET integrated database retrieval system