KEGG   Bacillus halodurans: BH2303Help
Entry
BH2303            CDS       T00039                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferas
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bha  Bacillus halodurans
Pathway
bha00040  Pentose and glucuronate interconversions
bha00052  Galactose metabolism
bha00500  Starch and sucrose metabolism
bha00520  Amino sugar and nucleotide sugar metabolism
bha01100  Metabolic pathways
bha01130  Biosynthesis of antibiotics
Module
bha_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BH2303
   00052 Galactose metabolism
    BH2303
   00500 Starch and sucrose metabolism
    BH2303
   00520 Amino sugar and nucleotide sugar metabolism
    BH2303
Enzymes [BR:bha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BH2303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: BAB06022
UniProt: Q9KAI4
Position
complement(2422878..2423699)
Genome map
AA seq 273 aa AA seqDB search
MEIKKAIIPAAGYGTRCLPITKVVPKEMFPINGKAALHYIVEEAVAAGIEEIFIILSRNR
TLIMDYFDRSIELETFLKKMNKQHLLEKLALPDVTIQFIRQPHANGLGDAIRLGERFVNG
EPFAVLLPDDLFISPKHTSVLAELVNVYKQYNKSIIGLQEVESELLKRYGVIAGHPLSSD
EYKIENVVEKPQTNPPSNLAIVGRYIFEPAIFQKLKNIGIGKGGEVQLTDAIKALLISHT
VIGKIIEGCRYDIGIEEDYQRLIQEFSEKKSST
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggaaattaaaaaagcgattattccagcagctggatatggaactagatgtcttccgatt
actaaagtcgttccgaaagagatgttccctattaatggtaaagcagctctccattacatt
gtggaagaagctgttgcagccggaattgaagaaattttcatcattctttcgagaaatcgc
acgttgattatggattactttgatcggtccattgaattggaaacatttctgaaaaaaatg
aataagcagcatctcctagaaaagttagctcttcctgatgtaaccatccaatttattcgt
caacctcatgccaacggattaggggatgccattcgattaggagaacgatttgtcaatgga
gaaccctttgctgttttgttaccagatgatttgtttatttctccaaaacacacgtccgta
ttagcagaactagtgaacgtttataagcaatacaataaaagtattattgggctccaagag
gtcgagtcggaactattaaagcgatatggagtcattgctggtcatccactgtcaagtgat
gaatataaaatagagaatgtggtagaaaaaccacagacaaatcctccgtctaacttagcc
attgttggacggtatatatttgaacccgccatcttccaaaagctaaaaaatatagggatt
ggcaaagggggagaagtacaattaacggacgcaataaaggctttgcttatttcgcatacc
gttataggaaaaatcatcgaagggtgtcgttatgacatcggcattgaggaagactaccaa
cgtttaatacaagagtttagcgaaaagaaaagctctacgtaa

DBGET integrated database retrieval system