KEGG   Bacillus halodurans: BH2815Help
Entry
BH2815            CDS       T00039                                 

Definition
(GenBank) glycine dehydrogenase subunit 1
  KO
K00282  glycine dehydrogenase subunit 1 [EC:1.4.4.2]
Organism
bha  Bacillus halodurans
Pathway
bha00260  Glycine, serine and threonine metabolism
bha00630  Glyoxylate and dicarboxylate metabolism
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BH2815
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BH2815
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     BH2815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDC-P Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAB06534
UniProt: Q9K935
Position
complement(2938735..2940078)
Genome map
AA seq 447 aa AA seqDB search
MNHRYLPMTTDDRQEMLQAIGVDSIEELFSDIPQDIRFKGKLNIPNALKEPELIRYFQQL
ANENVHLKDKASFLGAGVYDHYIPSIVDHVISRSEFYTAYTPYQPEISQGELQAIFEFQT
MICELTGMEVANSSMYDGPTALAEAAMMSCGHTKKKKILVSKAVHPEARDVLMTNAYGQR
LEVVEIDTNNGVTDVEHLKALYDEETACVIVQHPNFFGRLEPLAEIESVSHQGKATFVVS
SNPLALGLLKPPGAFGADVVVGDAQPFGIPTQYGGPHCGYFATTKKLMRKVPGRLVGQTT
DDQGQRGFVLTLQAREQHIRREKATSNICSNQALNALAAAVAMATIGKRGVKEMALQNVQ
KAAYAKSQLKANGVEIVAEGPCFNEFIIKLSSPLHEVEEALLAKGFIAGYDLGKVYPELE
GHMLVAVTEVRTKEEIDQFAKEVGMFA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatcgttacttaccaatgacaacggacgatcgacaggaaatgctacaggcgatc
ggtgtcgactcaattgaggaactgttttcggatattccgcaagatattcgcttcaaaggg
aagctgaacattccgaacgcgttaaaagagccagaactcattcgttattttcagcagtta
gcgaatgaaaatgttcacttaaaagataaagcctcttttttaggtgctggagtgtatgac
cattacatcccatcaattgtcgaccatgtcatttcacgctctgaattttatactgcatat
accccttaccagccggaaatttcccaaggggagttacaagccatctttgaatttcaaacg
atgatttgtgaattaaccggaatggaagtggccaattcatccatgtatgacggaccgaca
gcattggcagaagcagcaatgatgagctgtggacatacgaaaaagaaaaaaattcttgtt
tccaaagctgtccatccagaggcgcgcgatgtattaatgacgaatgcttatggacaacgt
ttagaagtagttgagatcgacacgaacaatggtgtaacggatgtagagcatttaaaggcg
ttgtatgatgaggaaaccgcttgtgtgatcgtgcaacacccgaactttttcggccgactt
gaaccattagcggaaattgaatcagttagtcatcaagggaaggcgacgttcgtcgtttca
agtaatcctcttgcgcttgggttattgaagccaccaggggccttcggagctgatgtggtc
gttggagatgctcaaccgtttggaattccaacacaatatggcggccctcactgcggatat
tttgccactacgaaaaagttgatgagaaaagtacctggacggctcgttgggcaaacgacc
gatgatcagggacagcgaggcttcgtgcttactctacaagcgagagagcagcatattcgg
cgtgaaaaagcgacatctaatatttgttcgaaccaagcccttaatgccctagccgctgcg
gttgctatggccacaatcggtaaacgtggcgtcaaggaaatggccttacaaaacgtacaa
aaagcggcatacgctaaatcccagcttaaggccaatggtgtagaaatcgttgcagaagga
ccttgctttaatgaatttatcattaagttaagcagtccgcttcatgaagtggaggaagcg
ttgcttgccaaaggattcattgcagggtacgacctggggaaagtgtatccagagcttgag
ggacatatgctcgtcgctgtgacagaggtaaggacaaaagaggagatagatcaatttgca
aaagaagtggggatgttcgcatga

DBGET integrated database retrieval system