KEGG   Bacillus halodurans: BH3067Help
Entry
BH3067            CDS       T00039                                 

Definition
(GenBank) BH3067; unknown conserved protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bha  Bacillus halodurans
Pathway
bha00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BH3067
Enzymes [BR:bha01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BH3067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAB06786
UniProt: Q9K8D9
Position
complement(3189058..3189642)
Genome map
AA seq 194 aa AA seqDB search
MKEWIVATKNKGKVAEFEAILGKRGFSVKSLLDYPAIEDIEETGSTFNENATIKAEAIAE
RFQRPVLADDSGLIIDALDGRPGIFSARYAGEEKDDQKNIEKVLRELQDIPWKARTARFH
CSIALARPQAETIVFEGTCEGYITTEPKGTGGFGYDPIFYVPSHDKTMAELTQEEKNKLS
HRYHALKQLDKWLD
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatggatcgttgcaacaaaaaataagggcaaggtagcagagttcgaagccatt
ttaggtaagagagggttttcggtcaaatcacttctcgattacccagcaattgaagacatc
gaagaaacgggaagcacatttaatgaaaatgcgacaatcaaggcagaggcgatcgccgag
cgttttcaacggcctgtacttgctgacgattcaggattaatcatcgacgccttggacgga
cgtccgggcattttctctgctcggtatgcaggggaagaaaaggatgatcaaaaaaacatc
gaaaaagtccttcgcgaattacaagacatcccgtggaaagcgcgaactgcacgcttccat
tgctccatcgcgctcgcccgcccgcaggcagagacaatcgtgtttgaaggaacgtgtgaa
gggtatatcacaacagagccaaaaggaacgggtggctttgggtacgatccaattttttat
gtaccgtcccatgacaaaacgatggcagaattgacgcaggaagagaaaaacaagctaagt
caccgataccacgcgttaaagcagttggataagtggcttgattaa

DBGET integrated database retrieval system