KEGG   Bacillus halodurans: BH3101Help
Entry
BH3101            CDS       T00039                                 

Definition
(GenBank) enoyl-CoA hydratase(3-hydroxybutyryl-CoA dehydratase)
  KO
K13767  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bha  Bacillus halodurans
Pathway
bha00071  Fatty acid degradation
bha00362  Benzoate degradation
bha01100  Metabolic pathways
bha01120  Microbial metabolism in diverse environments
bha01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    BH3101
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BH3101
Enzymes [BR:bha01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BH3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: BAB06820
UniProt: Q9K8A5
Position
complement(3216056..3216832)
Genome map
AA seq 258 aa AA seqDB search
MEPLKLAIDEGGVATITIARPPANALSRRVLEQLDHILTQVEKDDHVRVILLHGEGRFFA
AGADIKEFLQVKDGSEFAELAKQGQRLFDRMEAFSKPIIAAIHGAALGGGLELAMACHIR
LATEDTKLGLPELQLGLIPGFAGSQRLPRLVGRAKALEMMLTSEPITGSEAKTLGLINSL
HSEQTLIDDAKALAKKIAAKSLITTAMVLELVQYACDDKFVEGSEREAELFGKAFDSADG
KEGIQAFLEKRKPNFNDQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtggaacctttgaagcttgccattgacgaaggcggtgttgcgacgattacgattgcacga
ccgccggccaatgccctatctcgaagggtattggaacagcttgatcacattctcacgcag
gtggaaaaagacgatcacgtacgtgttattctcctccacggggaaggacgattttttgca
gcaggtgcagacataaaggaatttttgcaggtgaaggatggctcagaatttgcagaacta
gcaaagcagggccaacgtctttttgatcgaatggaagcgttctcaaaaccgattattgcg
gcaattcatggggccgcccttggcggagggcttgagctagcaatggcgtgtcacattcgg
ctagccacggaagatacgaagctcggcttaccagagttgcagctcggattaatcccaggt
tttgctggcagtcaacgcttgccacgtctcgttggccgagcaaaagcgttggaaatgatg
ttgacgagcgaaccgatcactggatctgaagcaaaaactttaggtcttattaattcccta
cattctgagcaaacgctcatcgatgatgcaaaagcattggcgaaaaaaatcgcagcaaaa
agtctaatcacgacagcgatggtgcttgaactcgttcaatacgcttgcgacgacaagttc
gtagaaggatctgaacgagaagcggagctttttggtaaagctttcgactctgcggatgga
aaggaaggcattcaagcctttttagaaaagcgcaagccgaactttaacgatcaataa

DBGET integrated database retrieval system