KEGG   Bacillus halodurans: BH3801Help
Entry
BH3801            CDS       T00039                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bha  Bacillus halodurans
Pathway
bha00071  Fatty acid degradation
bha00072  Synthesis and degradation of ketone bodies
bha00280  Valine, leucine and isoleucine degradation
bha00310  Lysine degradation
bha00362  Benzoate degradation
bha00380  Tryptophan metabolism
bha00620  Pyruvate metabolism
bha00630  Glyoxylate and dicarboxylate metabolism
bha00640  Propanoate metabolism
bha00650  Butanoate metabolism
bha00900  Terpenoid backbone biosynthesis
bha01100  Metabolic pathways
bha01110  Biosynthesis of secondary metabolites
bha01120  Microbial metabolism in diverse environments
bha01130  Biosynthesis of antibiotics
bha01200  Carbon metabolism
bha01212  Fatty acid metabolism
bha02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BH3801 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BH3801 (mmgA)
   00640 Propanoate metabolism
    BH3801 (mmgA)
   00650 Butanoate metabolism
    BH3801 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BH3801 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BH3801 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BH3801 (mmgA)
   00310 Lysine degradation
    BH3801 (mmgA)
   00380 Tryptophan metabolism
    BH3801 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BH3801 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BH3801 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BH3801 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bha04147]
    BH3801 (mmgA)
Enzymes [BR:bha01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BH3801 (mmgA)
Exosome [BR:bha04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BH3801 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAB07520
UniProt: Q9K6C8
Position
complement(3922211..3923389)
Genome map
AA seq 392 aa AA seqDB search
MKTAIISGVRTPFGKFGGSLSTLTAAQLGGHAIRETLKRANWRGERVDDLIMGNVLQGGQ
GQLPSRQALKEADLPWDVRTETINKVCASGMRSVTLADQLIRSGSSKVVVAGGMESMSQA
PYYVPKARWGARMGHVEMIDGMVFDGLTCAFTGVHMGTYGNGTAHELAISREAQDEWAYR
SHQRAIAAIGAGRLEEEIVPVEVPQRKGEPLLVACDEAPRKDTSMESLKNLRPVFGKEGT
ITAGNAPGVNDGAAAMLLMSEEEAKSAGMAPLAIIEGHTALATEPKDFPKTPGLVIQKLL
QDTGKTPAEIDLFEINEAFAAVALASQQIAEIDPEKVNVNGGAVALGHPIGASGARIILT
LAYELRRRGGGLGIAAICSGGGQGDAVLIRVP
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacagccatcattagcggcgtgagaacacctttcgggaaatttggcgggagtcta
tcgacactaacagctgctcagctagggggacatgcaattcgtgaaacgttaaaaagggca
aattggcgtggggaacgagtagacgatctgatcatggggaatgtgttgcaaggggggcaa
ggacagctcccgtcaaggcaagcattaaaagaagccgacttaccatgggacgtgcgtacg
gagacgatcaataaagtatgcgcgagcgggatgcgtagcgtgacattggcggaccagttg
atccgttcggggagctcaaaagtcgttgtagctggaggaatggaatcgatgagtcaagcg
ccctactatgtgccaaaggcgcgttggggtgcaagaatgggccatgtggaaatgatcgat
ggcatggtatttgacggactaacatgtgccttcacaggtgttcatatgggaacgtacgga
aatgggaccgcacatgagttagcgatcagccgagaagcccaggatgaatgggcgtaccgt
agtcatcagcgtgccattgcggccatcggagcagggcggctcgaagaagagatcgttcca
gtggaagtgccgcagcgaaaaggggaaccattgctcgtcgcatgtgatgaagcgccgcga
aaggatacgtcaatggagtcactgaaaaaccttcgaccggtgtttggcaaagaagggacg
attacagccggaaatgctcctggagtgaatgatggtgctgccgcgatgttgctcatgtct
gaggaggaggcgaagagcgctggcatggcccccttagccatcattgaagggcatactgcg
ctagcgaccgagccgaaggatttcccgaaaacaccgggccttgtcatccaaaagctatta
caggacactgggaaaacgcctgctgagatcgatttgttcgaaattaatgaggcttttgcc
gccgttgcccttgccagtcagcaaatcgccgagattgaccctgaaaaagtaaatgtcaac
ggtggagccgttgcgttaggtcatccgattggtgcaagtggtgcacgcatcatccttaca
cttgcctacgaattgcgccgtcgaggcgggggactaggcattgcagcgatctgcagtggc
ggaggtcaaggggatgctgtacttattcgcgtaccgtaa

DBGET integrated database retrieval system