KEGG   Bacillus halodurans: BH3949Help
Entry
BH3949            CDS       T00039                                 

Definition
(GenBank) L-iditol 2-dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bha  Bacillus halodurans
Pathway
bha00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BH3949
Enzymes [BR:bha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BH3949
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BH3949
    1.1.1.-  
     BH3949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: BAB07668
UniProt: Q9K5Y6
Position
4088038..4089084
Genome map
AA seq 348 aa AA seqDB search
MQALRWHGVKDVRVDDIAEPATLKGKVKIKVKWCGICGSDLHEYAAGPIFIPQNSPHSLT
EEKAPIVMGHEFSGQVVEVGDGVTKCEEGDRVVVEPIFACGTCTACKQGKYNLCEQLGFL
GLAGGGGGFSEYVTVDEHMVHKIPDTVSFEQGALVEPAAVALYAVRQSQFNVGDQAVVFG
TGPIGLLVIEALKASGASKIYAVELSTERRQRAEQLGAIALNPAEVNVVEEIQRLTDGGA
DVSFEVTGVPIVLTQAIESTKLNGQTMIVSIFEKEASFQPNLVVMRERNIAGIIGYRDIF
PAVISLMNQGYFSAETLVTKRIGLHDIVEQGFEALMKTNCNIKCDTTK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
ttgcaggctttaagatggcatggagtaaaagacgtaagagttgacgacatcgcagaacct
gcaacgcttaaagggaaagtaaagattaaagtgaaatggtgtggcatttgtggaagtgat
cttcatgagtatgcggccggtccaatctttattccacaaaatagccctcattctctaacg
gaagaaaaagctccgattgtgatgggccatgagttttctggacaagtggtggaagtaggc
gatggtgtgaccaaatgtgaagagggcgaccgtgtagtggtcgagccgatttttgcttgt
ggtacttgtaccgcctgcaagcaaggaaagtataatctttgcgagcaattagggttcctc
ggtttagctggaggtggaggtggtttctcggaatatgtgacagtagacgagcacatggtt
cacaaaattccggacactgtatccttcgagcaaggggccttagtcgagcccgccgccgtt
gccttatatgcggtccgccagagccagtttaatgtcggtgaccaagcggttgtattcggt
acaggcccaatcggattattggttattgaagcgcttaaagcttcgggggcctcaaagatt
tacgcagtagaactctcaaccgaacggagacagagagcagaacaattaggtgccattgcc
ctgaacccagcggaagtaaatgtagtggaagaaattcagcgtctaaccgatggcggtgct
gatgtgtcctttgaagtaaccggtgtccctattgtcttaacacaggcgatcgagtccacc
aagctaaacgggcaaacgatgattgtgagcatctttgaaaaagaagcctcttttcaacca
aacctagttgtcatgcgagaacgaaacattgcagggattattggctaccgcgacattttc
ccagcggtcatcagcttgatgaatcaaggctacttttccgctgagacgttagtcaccaag
cggatcggcctacatgacattgtagagcaaggcttcgaggctttaatgaagacgaattgt
aatattaagtgcgacaccacaaaataa

DBGET integrated database retrieval system