KEGG   Blautia hansenii: CGC63_00215Help
Entry
CGC63_00215       CDS       T05095                                 

Definition
(GenBank) N-acetylneuraminate lyase
  KO
K01639  N-acetylneuraminate lyase [EC:4.1.3.3]
Organism
bhan  Blautia hansenii
Pathway
bhan00520  Amino sugar and nucleotide sugar metabolism
bhan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CGC63_00215
Enzymes [BR:bhan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.3  N-acetylneuraminate lyase
     CGC63_00215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHDPS
Motif
Other DBs
NCBI-ProteinID: ASM68053
UniProt: C9L8Y6
Position
42000..42926
Genome map
AA seq 308 aa AA seqDB search
MANLEKYKGIIPAFYACYDEEGNVSPERVRALTQHFIDKGVKGVYVNGSSGECIYQGVEE
RKIIIENVMAVAKGKLTVINHVACNNTKDSVELAKHSESVGVDAIASIPPIYFRLPEYSI
AAYWNAISEAAPNTDFIIYNIPQLAGTALTMSLFAEMMKNPRIVAVKNSSMPTQDIQMFK
ATGKEAKGEFVVFNGPDEQFVAGRAIGADGGIGGTYGVMPELFLKLNDMIAAGECEKATE
LQYDINEIIYKMCSSHANMYAVAKEILRINENLDLGGVRLPLENLQEADKMIAKEAADMV
NAVKEKYL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttagaaaaatataaaggaattattccggcattttatgcttgttatgacgaa
gaaggtaatgtaagtcctgaaagagttcgtgcattgacacagcattttattgacaaaggt
gtaaagggagtttatgtaaacggttcttcaggagaatgtatttatcagggtgtagaagaa
cgtaaaattattattgaaaatgtaatggcagttgcaaaagggaaactgacagttatcaat
catgttgcatgtaacaatacaaaggacagcgtagaattggcaaaacattctgaaagtgta
ggtgttgatgctattgcttccattcctccaatttatttccgtttgccggagtattcaatt
gcggcatactggaatgcaatcagcgaagcagcgccaaatacagattttattatttataat
attcctcagttagcaggaacggctcttactatgagtttgtttgctgaaatgatgaaaaat
cctaggatagtggctgtaaaaaattcttctatgcctacacaggatattcagatgtttaag
gcaacgggaaaagaggcaaaaggagagtttgtagtatttaacggaccggatgaacagttt
gtagcaggacgagctattggagcagatggaggtattggaggaacttatggtgtaatgcct
gagttattcttgaaattaaatgatatgattgcagcaggtgaatgcgaaaaggcaacagaa
ctccagtatgatattaatgagattatttacaagatgtgttccagtcatgcaaatatgtat
gcagttgcaaaagaaattcttcgtattaatgaaaatctggacttgggcggcgttcgtctt
cctttggagaatttacaggaagcagataaaatgattgcaaaagaggcagcagatatggta
aatgctgttaaagaaaaatatctgtag

DBGET integrated database retrieval system