KEGG   Blautia hansenii: CGC63_00880Help
Entry
CGC63_00880       CDS       T05095                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bhan  Blautia hansenii
Pathway
bhan00260  Glycine, serine and threonine metabolism
bhan01100  Metabolic pathways
bhan01110  Biosynthesis of secondary metabolites
bhan01120  Microbial metabolism in diverse environments
bhan01130  Biosynthesis of antibiotics
bhan01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhan00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CGC63_00880
Enzymes [BR:bhan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     CGC63_00880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASM68174
UniProt: C9LCA9
Position
complement(179729..180769)
Genome map
AA seq 346 aa AA seqDB search
MYSFQNDYSEGMQPAILRALETINYHQNHSYGQDIHSDAARDYIQEALEDFSVDIHFIAG
GTLTNLTFISHILKPFEAVISAETGHINTHETGAIEATGHKVCPVLTKNGKLTPDLIRPV
LDMHENEHWVDPRLVYVSNPTEVGTVYTKEELEDLYAFCKRHDLYFYIDGARLAAALAAK
EETHLTFPDLPKLCDAFYIGGTKVGAMFGEALVLVNENFKERFRFNMKQKGAILAKGWFL
GVQFEELFKNNLYIEAGAHSIAMMKPIKEAFEKAGIPLLCEAPTNQIFPIFPNALADEIN
KKYLTTFQCKPDKDHTCLRFCTSWATNENAVKDFVEDFEEMCNRLL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtacagttttcagaatgattacagcgaaggtatgcagcctgctattcttcgtgcttta
gaaactataaactatcatcaaaatcattcctacgggcaggatatccactctgatgctgcc
agagattatattcaggaagcattagaggactttagtgtcgatattcattttatcgcaggg
ggaactctgacaaacctgacttttatttctcacattttaaaaccgtttgaggcagtaatc
agtgcagaaacaggtcatatcaacacccatgaaacgggcgctattgaagccacaggacac
aaggtatgcccagtccttaccaaaaacgggaaactgactcctgacttaatccgtcctgtt
cttgatatgcacgaaaacgaacattgggtagaccctcgtcttgtgtatgtttccaatcct
acggaagtgggaactgtttataccaaagaagaattagaagatttatatgctttctgtaaa
cgtcacgacctgtacttttatatagatggcgcccgtcttgccgccgcactggcagcaaaa
gaggaaacacaccttactttccccgatttgccaaagctgtgtgatgctttttacatcgga
ggaacaaaagtcggagctatgtttggagaagctttagttcttgtaaatgaaaacttcaag
gaacgtttccgtttcaacatgaagcaaaaaggagctattctggcaaagggctggttctta
ggtgttcaatttgaagaattatttaaaaataatctttatattgaagcaggcgctcatagc
attgccatgatgaagccaataaaagaagcttttgagaaagccggtattccgcttttatgc
gaagcacctacaaaccagattttccctattttcccaaatgctcttgcggatgaaatcaat
aaaaaatatctgactaccttccagtgtaaaccggataaagaccatacttgtctgcgtttt
tgtacttcatgggcgacaaacgaaaatgcagtaaaagattttgtagaagattttgaagaa
atgtgcaatagacttttataa

DBGET integrated database retrieval system