KEGG   Brachyspira hyodysenteriae ATCC 27164: BHYOB78_01110Help
Entry
BHYOB78_01110     CDS       T04742                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bhd  Brachyspira hyodysenteriae ATCC 27164
Pathway
bhd00471  D-Glutamine and D-glutamate metabolism
bhd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BHYOB78_01110
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bhd01011]
    BHYOB78_01110
Enzymes [BR:bhd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BHYOB78_01110
Peptidoglycan biosynthesis and degradation proteins [BR:bhd01011]
 Precursor biosynthesis
  Racemase
   BHYOB78_01110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ANN62503
UniProt: A0A3B6W270
Position
complement(1356379..1357218)
Genome map
AA seq 279 aa AA seqDB search
MNIDSLSSNMPIAVFDSGLGGLTVLKKLIEMMPNENYVYIGDNANIPYGDKSKEEIINLT
LKMTDFLVEQKCKMIIIACNTITACSYDILKQKYHIPVIEVISNAVIDALDKTKNNNISI
MATEFTVNSNIYKNKIIEFNKQAKVTQTACKDLCPMIENDWYSYENRLEILKNYLENIDK
NSDTLILGCTHYPHIINDIKKLLENGIINSINNIIDPSYHTAISAKEYLKNNNLLSDNKI
ENSKTIIFSTEKSEKINKLINMLLPKDTYKNYSIKYVDL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgattctctttcatcaaatatgcctatagcagtttttgattcaggattagga
ggtttaactgttttaaaaaaattaattgaaatgatgcctaatgaaaattatgtatatata
ggtgataatgccaatataccatatggtgataaatctaaagaagaaataataaacctaaca
ttaaaaatgactgactttttagttgagcaaaaatgcaaaatgattattatagcatgcaat
actataacagcttgctcttatgatattttaaaacaaaaatatcatatacctgtaattgaa
gttatatcaaatgctgtaatagatgcattggataaaacaaaaaacaataatatatcaata
atggctacagagtttacagttaattctaatatatataaaaataaaataatagaatttaat
aaacaagcaaaagtcactcaaacagcatgcaaagacttatgtcctatgatagaaaatgat
tggtatagttatgaaaacagattagaaatattaaaaaactacttagaaaatatagataaa
aattcagatactttaatattaggatgcactcattatcctcatataattaatgatataaaa
aaattattagaaaatggtattataaattctataaataatataatagatccttcatatcat
acagcaatatcagccaaagaatatttaaaaaataataatttattatctgataacaaaata
gaaaattctaaaacaattatattttccacagaaaaatcagaaaagataaataaattaata
aatatgctgcttccaaaagatacttataaaaattatagtataaaatatgtagatttataa

DBGET integrated database retrieval system