KEGG   Brachyspira hyodysenteriae ATCC 27164: BHYOB78_05280Help
Entry
BHYOB78_05280     CDS       T04742                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
bhd  Brachyspira hyodysenteriae ATCC 27164
Pathway
bhd00051  Fructose and mannose metabolism
bhd00520  Amino sugar and nucleotide sugar metabolism
bhd01100  Metabolic pathways
bhd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BHYOB78_05280
   00520 Amino sugar and nucleotide sugar metabolism
    BHYOB78_05280
Enzymes [BR:bhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     BHYOB78_05280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase IspD
Motif
Other DBs
NCBI-ProteinID: ANN63292
UniProt: A0A3B6VRU6
Position
complement(409923..410987)
Genome map
AA seq 354 aa AA seqDB search
MKKSILIMAGGIGERLWPLSRESKPKQFLNIIENKSLIEQTIDRALKITSEDNIFIITGK
RYKEVFNKYMPSFKNIIYEPIGRDTAAAIALGATYIKEKIGNAMIAILPADPIIKNEDLF
IKSIENAIEVSENTNEVVVVGIKPSRAETGYGYIKIKDNIKDDVYNVDRFVEKPNYENAC
KFLEDGNYLWNSGMFIWSIDNILNSIKELMPDTYNKTIKTLEAKDDTQKEEIFKTIDKIS
FDFGIMEKLNNIKCIKSRFFWDDLGAFSALGRIHDKDADNNVIIGNVYAKEAKSNIIIND
DKDTFIAIDGVDDLTIVKSNGVLLIYPNNKDSKIKDILKDIREKDELKDKRNLL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatccatacttataatggcaggaggaattggtgaaagattatggcctctaagc
agagaaagtaagccaaaacaatttttaaatattatagaaaataaatcacttatagaacaa
acaatagacagagcattaaaaattactagtgaagataatatttttataataacaggaaaa
agatataaagaagtatttaataagtatatgccttccttcaaaaatataatatatgagcca
attggaagagatacagcagcagctattgcattaggagctacttatataaaagaaaaaata
ggaaatgcaatgattgcaatacttccagctgatcctattataaaaaatgaagatttattt
ataaaatctattgaaaacgccattgaagtaagtgaaaatactaatgaagttgtagtagta
ggaattaaacctagcagagcagaaacaggatacggatatataaaaataaaagataatatt
aaagatgatgtatataatgttgatagattcgtagaaaaacctaattatgaaaatgcatgt
aaattcttagaagatggtaattatctatggaacagcggaatgtttatatggtctatagat
aatattcttaattcaataaaagaattaatgcctgatacatacaataaaactataaaaaca
ttagaagcaaaagatgatactcaaaaagaagaaatattcaaaactatagataaaatatct
ttcgactttggtataatggagaaattgaataatattaaatgcataaaatccagattcttt
tgggacgatttgggcgcattttctgcacttggaagaatacatgataaagatgctgataat
aatgtaataattggaaatgtatatgctaaagaagcaaaaagtaatatcataataaacgat
gataaagatactttcatagcaatagacggagttgatgatttaactatagtaaaatctaac
ggcgtacttttaatttatccgaataataaagattcaaaaattaaagatatattaaaagat
ataagggaaaaagatgaattaaaagataaaagaaatctgctttga

DBGET integrated database retrieval system