KEGG   Brachyspira hyodysenteriae ATCC 27164: BHYOB78_06355Help
Entry
BHYOB78_06355     CDS       T04742                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bhd  Brachyspira hyodysenteriae ATCC 27164
Pathway
bhd00220  Arginine biosynthesis
bhd00330  Arginine and proline metabolism
bhd01100  Metabolic pathways
bhd01110  Biosynthesis of secondary metabolites
bhd01130  Biosynthesis of antibiotics
bhd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BHYOB78_06355
   00330 Arginine and proline metabolism
    BHYOB78_06355
Enzymes [BR:bhd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BHYOB78_06355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: ANN63499
UniProt: A0A3B6VV46
Position
complement(193355..194239)
Genome map
AA seq 294 aa AA seqDB search
MSKTIRLIYPQWQGGIISHWIKELKPEDSSRGYYLGAKLLSILAPKNDNHETLEVPVSLD
IKNREIKNGIIDYDFIVSQTKNALYILSKNNPDKIITFGGECSVSVVPFTYLNKKYDNDV
ALIWIDAHPDITLPEDNTYAGYHAMAVSACMGNVDKYISSILPSKISADKILFVGLRDWE
RDEIKKRQEEYGITHFAPETTSSSSEVVIEWLKKSNASKVLIHFDLDVLDPNEIIAAVGV
SPNGMKINEAVRIINDIAKEKEIVGFTIAEHMPRIEIMLKNMMADLSLFNELNK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaactataagattaatttatccgcagtggcagggaggaattatatctcattgg
ataaaggaattaaagcctgaagattcttcaagaggttattatcttggggcaaaattatta
agcatacttgcccctaaaaatgataatcatgaaactttagaagttcctgtctctttagat
ataaaaaatagagaaataaaaaacggtattattgattatgattttatagtatctcagact
aaaaatgcattgtatattttaagcaaaaataatcctgataaaataataactttcggaggc
gaatgttctgttagtgtagtgcctttcacatatttaaataagaaatatgataatgatgtt
gctttaatttggatagatgctcatcctgatattactttgcctgaagataatacttatgcc
ggatatcatgctatggctgttagtgcctgtatgggtaatgttgataaatatataagctct
atacttccaagcaaaatttcagctgataaaatattatttgtagggcttagagattgggaa
agagatgaaataaaaaaacgtcaagaggaatacggcataactcatttcgctcctgaaact
acttcctcatcaagtgaagttgtaatagaatggttaaaaaaatctaatgcttctaaggtt
ttgatacattttgatttggatgtgcttgaccctaatgaaataatagctgctgtcggagtt
tctcctaatggaatgaagataaatgaagcagtaagaataataaatgatattgcaaaagaa
aaggaaattgttggctttactatagcagaacatatgccaagaattgaaataatgcttaaa
aatatgatggctgatttgagtttatttaatgagctcaataagtaa

DBGET integrated database retrieval system