KEGG   Bartonella henselae Houston-1: BH05620Help
Entry
BH05620           CDS       T00180                                 

Gene name
pcm1
Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bhe  Bartonella henselae Houston-1
Brite
Enzymes [BR:bhe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BH05620 (pcm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_25 Methyltr_RsmB-F Methyltransf_11 RrnaAD MTS Methyltransf_23 Methyltransf_4 GCD14 Methyltransf_3 DUF938 DREV NodS
Motif
Other DBs
NCBI-ProteinID: CAF27370
UniProt: A0A0R4J7D4
Position
659495..660154
Genome map
AA seq 219 aa AA seqDB search
MDQKGILRFHEELASLVLKMRSKGIDDVRFFTALEKIPRQQFVSSPWFKSAYDNKVIPIE
CGEYIERLEEQLLILYALSLKKKHRVLEIGTGSGFCTAFMACLSDRVITVDRYKTLVDLA
RQKFQTLGIENIVVRQIDGSRIITGFGSFDRILIWPSRSDEPKEFLELLTENGILIQAIG
PDEGVQTITRYTKIASRFECLEMFQVRYQPFIEGIAETL
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagggtattttacgatttcatgaggagctagctagtcttgtgctaaaaatg
cgcagcaaaggaattgatgatgttcgcttttttacggcattggagaaaattccgcgtcaa
cagtttgtcagttctccttggtttaagagcgcttatgataataaagttattccaattgag
tgtggtgaatatattgagcgtttggaagagcagctcttgattctttatgctttatctttg
aaaaaaaaacatcgtgtcttagagattggtaccggttctggtttttgtactgcctttatg
gcatgccttagtgaccgtgtgataacagttgatcgctataaaacgcttgttgatttggcg
cgtcaaaaatttcaaactttaggcattgaaaatattgttgtacggcagattgatggaagc
cgtattattacaggttttggatcgtttgatcgtattcttatttggccatcacgttctgat
gaaccgaaggaatttttagaacttttaactgaaaatggaattctcattcaagctatagga
cccgatgaaggggtacaaaccattacgcgttatacaaaaattgctagccggtttgagtgc
ttagaaatgtttcaagtgcgttatcaaccctttattgaaggtattgcagaaactctttga

DBGET integrated database retrieval system