KEGG   Bartonella henselae Houston-1: BH05710
Entry
BH05710           CDS       T00180                                 

Gene name
kdsA
Definition
(GenBank) 2-dehydro-3-deoxyphosphooctonate aldolase
  KO
K01627  2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC:2.5.1.55]
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe00540  Lipopolysaccharide biosynthesis
bhe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhe00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    BH05710 (kdsA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:bhe01005]
    BH05710 (kdsA)
Enzymes [BR:bhe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.55  3-deoxy-8-phosphooctulonate synthase
     BH05710 (kdsA)
Lipopolysaccharide biosynthesis proteins [BR:bhe01005]
 Lipid A
  BH05710 (kdsA)
SSDB
Motif
Pfam: DAHP_synth_1
Other DBs
NCBI-ProteinID: CAF27379
UniProt: Q6G409
Position
670711..671550
AA seq 279 aa
MSEPNAIVKVGNIIFSNEAPFSLIAGPCQIESRDHAFEMAGRIKTITDQVGIGFVYKSSY
DKANRTSLSAVRGVGLENAMAIFSDLKKEFGCPILTDVHTEEQCTVVASTVDILQIPAFL
CRQTDLLVAAAKTGRVINIKKGQFLAPWDMKNVLRKVTQSGNRNVMLCERGTSFGYNRLI
SDMRSLPILRSFGAPVIFDATHSVQEPGGQGDSSGGQRQFVEILARAAVSVGVAGIFLET
HQDPDNAPSDGPNMIKIDHLQRLLETLMEFDYLSKKTIE
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtctgaaccaaatgccattgtgaaagttggaaatattattttttcaaatgaagcaccc
ttttcattaattgcggggccatgtcagatagaaagtcgcgatcacgcttttgaaatggct
ggccgaattaagacaattacggatcaagttggtattggatttgtttataaatcgagttac
gataaagccaacaggacgtctttgagtgccgtacggggtgttggtcttgaaaatgcaatg
gctattttctctgatttgaagaaggaatttggttgtccgattttgactgatgtgcataca
gaagagcaatgtacggttgttgcttcaacagtagatattttgcaaatacctgctttttta
tgtcgtcaaacagatcttttggtggcagcagccaaaacggggcgtgttatcaacattaaa
aaaggtcagtttttagcaccgtgggatatgaagaatgttttaagaaaggtcacgcaaagt
ggtaaccggaatgttatgctttgtgagcgaggtacttcatttggttataatcgacttatt
tctgatatgcgttcattgcctattttgcgttcatttggtgctcctgttatttttgatgca
acgcattctgttcaggagccaggtggtcagggtgattcatctggtgggcagcgtcaattt
gttgaaattttggcgcgtgcggctgtttcggttggggtggccggtatttttttagaaacg
catcaagatccagataatgctccttctgatggaccgaatatgattaaaattgatcattta
caaagactgcttgagactttaatggaatttgattatctgtcaaagaagacaattgaatag

DBGET integrated database retrieval system