KEGG   Bartonella henselae Houston-1: BH11960Help
Entry
BH11960           CDS       T00180                                 

Definition
(GenBank) hypothetical protein
Organism
bhe  Bartonella henselae Houston-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4159 BatA DUF5345 PTPS_related
Motif
Other DBs
NCBI-ProteinID: CAF27979
UniProt: A0A0H3LZ81
Position
1328993..1331797
Genome map
AA seq 934 aa AA seqDB search
MSFAAPLLLLGLLSLPIIWWLLRITPPTPRKELFPPLRFLPKSNNQQEAAHRTPWWLSLL
RLTIAALIIIALAKPTWNQKPIVLSGSQPLALIIDNGWASTREWKKRITIAEDLLTQAEK
QQKNVYFLATAESDIFNIGPLPAKVVKQHLMHLQPQPWPINRVRALKKLLETTKDKPLDI
AYLSDGLKTNEDDQAFALIEQLKPKTLLWYLADISDLTGITAIENNNGLLAARIIRATTH
GKKVVVLNLYDLNNKLLGRFTTNFNAGETTAFVPFNLPLELRNDIAWIKIENHAHAAATF
LVDSHNRINRVALLSPSVNEMTQPLLSPFYYIIKALQGHAQIITAGGKELSVDIDHLLKQ
NPSVFIMGDIVNMSEEAEKKLSDFINKGGAFIRFAGENLSATEHHDSLLPVPLRPGKRLL
GSIMSWAKPQKLAPFTKNSFFFDLPFPKDVTVSRQILAEPSSDLFEKTWLSLADGTPLIT
AASRGKGTVIFIHIAPDPTWSNLPLSGFFAQMLQKLVTLSAYENKNSTQRKTTTVQNPWK
TLTADGKLQSPPSDVVPLVIDAQNPILASSHNPPGFYGFKNNLYALNLLNSSSRLMKQSS
LPSSLSKNPLSYDTKEKHLTGLLLGLAILLFALDHFLILWMGGVFFLNQRRNMFLFLPLA
ISLIVLFSDSPMLYAQGTENHDETAVQAAGATHLAYIITNNSEIDATSKSGLEALSQFIA
ERTMLSPGSVTAINLEKDELAFYPLIYWPIDSHSSLPTQKSLEKINSFMKHGGTVLFDTR
DQIQTDLSLEGAATPATQKLRAILKRLNIPAIEPASADHVIARSFYIMPDFPGLYRGSPL
WIESSSINKKNNNPLGFGDNVSSLLITANNFAGAWALDEKGMWKYPLIPNDPVQRLWAFR
AGLNIVIYVLTGNYKADQVHVPALLERFNKERRQ
NT seq 2805 nt NT seq  +upstreamnt  +downstreamnt
ttgagttttgctgctcccctccttttactagggcttttatccttaccgattatttggtgg
ttgttgcggataacacctccaacgccgcgtaaagagctctttccccctttacgctttctg
ccgaaatcaaataatcagcaggaagccgcacatcgcacaccttggtggttatcgttgtta
cgattaaccatagctgcactcattattatcgctttggcaaaacccacctggaatcaaaag
ccaattgtactctccggatctcaaccacttgcacttattatcgataatggatgggcatct
acgagagagtggaaaaaacgtattactatcgccgaagacctcctcacacaagcagaaaaa
cagcaaaaaaatgtttattttcttgcaacagccgaaagtgatattttcaatattggtccc
ttacctgcaaaagttgtaaaacaacatttaatgcatttgcaaccacaaccttggcctata
aaccgtgtacgtgcactaaaaaaacttcttgaaacaaccaaagataaacctcttgatatt
gcttatttaagcgatggattaaaaacaaacgaagatgatcaagcttttgctctcatcgaa
caattgaaacccaaaacactgttgtggtatcttgctgatatttccgacctaaccggcata
acagccatagaaaataacaatggactcctcgcagcacgcatcattcgtgcaaccacacac
ggaaagaaagtggtcgtattaaacctttatgatttaaacaataaactccttggccgtttt
acgacaaacttcaatgccggagaaacaacagcttttgttccttttaacctaccacttgaa
ttacgcaacgatatcgcatggataaaaattgaaaaccatgcccacgccgcagccactttc
ttagttgatagccataatcgaataaaccgcgttgctcttctatcaccaagtgtcaatgaa
atgacacaaccgctactttctccgttttattacattatcaaggcattgcaaggccatgcg
cagattataacagcaggaggaaaagagctttccgtcgatattgatcacttactcaaacaa
aatccatctgtttttatcatgggtgatattgtcaacatgtcagaagaagcagaaaaaaag
ctttctgattttatcaataaagggggagcattcatccgttttgcaggagaaaatttaagt
gctacagaacaccatgatagcctcttgccagtccccttacgtcctggcaaacgtttgctt
ggaagtatcatgtcttgggctaagccgcaaaaacttgcaccttttaccaaaaatagcttt
ttctttgatcttccgtttccaaaagatgtcactgtctcacgacaaattctagcagaaccg
agctcagatctttttgaaaaaacgtggcttagtcttgctgatggaacgccccttattaca
gcggctagtcgtggtaaaggcacagttatttttattcatattgcacctgatcccacatgg
tcaaatcttcctctttctggtttttttgcacaaatgttgcaaaaactcgtcacattgagt
gcctatgaaaataaaaactcaacacaaagaaaaacaacaacagtacaaaatccttggaaa
acattaaccgctgatggaaaactacaatcccctccttctgatgttgttccactagtcatt
gatgcacaaaatccaattcttgcctcctctcataacccacctgggttttacggctttaaa
aataatctttatgcactcaatctcttaaattcttcatcgcgcttgatgaaacaatcatca
ttgccatcttccttaagtaagaatcccttatcctacgatacaaaagagaaacatctcact
ggtctacttttaggattagccatcttattattcgctttggaccattttctcattttatgg
atggggggcgttttttttctcaatcaacgccgtaatatgttcctttttcttcccctggca
ataagtcttatcgtcttgttctcagacagtccaatgttatatgcgcaaggaacagaaaat
catgatgaaaccgcagtacaagcagctggagcaacacatcttgcttatattataaccaac
aactctgaaatcgatgcaacgagtaagagcgggctagaagcactcagtcaatttattgca
gagcgtacaatgctttcacctggttctgtaacagcaattaatcttgagaaagatgagctc
gctttctatcctctcatttattggcccattgattctcatagttctttgccaacacaaaaa
agtcttgaaaaaataaatagttttatgaaacacggaggtacagttttatttgacacgcgc
gatcaaatacagaccgacctcagtcttgaaggcgctgccaccccagctacacaaaaatta
cgcgccattttaaagagattgaacattccagccattgagcccgcatcagctgatcacgtt
attgcgcgttctttttatattatgccagattttcctggtctttatcgtggttcaccttta
tggattgaatcatcatcaataaataaaaaaaacaacaaccctcttggcttcggtgataac
gtaagttctcttcttatcaccgcgaataactttgcgggtgcttgggcactagacgaaaaa
ggcatgtggaaatacccacttattcctaatgatccggtgcaacgcctatgggcatttcga
gcaggattaaatattgttatctatgttcttaccggaaactataaagctgaccaagttcac
gttcctgcactcttagagcgctttaacaaagaaagaaggcaatga

DBGET integrated database retrieval system