KEGG   Bartonella henselae Houston-1: BH13290
Entry
BH13290           CDS       T00180                                 
Name
(GenBank) 17-kDa antigen precursor
Organism
bhe  Bartonella henselae Houston-1
SSDB
Motif
Pfam: FAM186A_PQQAQ T4SS DUF3576 DUF2968 FtsL_2 DUF4140
Other DBs
NCBI-ProteinID: CAF28102
UniProt: A0A0R4J8X8
Position
1515772..1516218
AA seq 148 aa
MKKYSLVTLLSLFCISHAKAQTATLTDEYYKKALENTQKLDVAKSQTAESIYESATQTAN
KIKDINNQLANLKADTKTKPEQLQALQIELTLLQAQLQADTLKIQSLAMIQAKDTKTKEE
LREEQTQKKHEDLQKQLKEKLEKSDVRL
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaaaaatatagcttagtcacattgttatctttattttgcatctctcatgcaaaagca
caaacagcaacccttactgatgaatattataaaaaagccttagaaaacacgcaaaaatta
gacgttgcaaaatcacaaacagctgagtctatttatgaatctgcaacacaaactgcaaac
aaaattaaggacataaacaatcaacttgcaaatcttaaagcagatacaaagactaaacct
gaacaattgcaagccctgcaaatagagctgactcttctccaggcacagctgcaagcggat
actttaaaaatccagtctcttgctatgattcaagcaaaagatacgaaaacaaaagaagaa
ttgcgtgaagagcaaacacaaaaaaagcatgaagatcttcaaaaacaattaaaagaaaaa
cttgagaaatctgatgtccgactttag

DBGET integrated database retrieval system