KEGG   Bartonella henselae Houston-1: BH13310
Entry
BH13310           CDS       T00180                                 
Name
(GenBank) 15-kDa antigen protein
  KO
K03202  type IV secretion system protein VirB7
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bhe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BH13310
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bhe02044]
    BH13310
Secretion system [BR:bhe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BH13310
SSDB
Other DBs
NCBI-ProteinID: CAF28104
UniProt: A0A0R4J6M4
Position
1517298..1517708
AA seq 136 aa
MVHFVRCIQNKIPHALPMSSCVVFKSIYEFKKMKQKITFVMILIIALTGCASLTGPKKPP
RCNGKVTRALNRDKWDWDNKNLILQEKNVKPVRTPIILNTLENEKATATVTLKENSLNSI
TRETLPENTMEIAREN
NT seq 411 nt   +upstreamnt  +downstreamnt
atggtgcattttgtaagatgtattcagaacaagatcccccatgcactccctatgagttca
tgcgttgtatttaaaagtatctatgagtttaaaaaaatgaaacaaaaaataacttttgtt
atgatcctgataattgcccttacaggctgcgcctctcttactggccccaaaaaaccacca
agatgtaatggcaaagttacccgcgctttaaatagagataaatgggattgggacaataaa
aacctcatcctacaagaaaaaaatgtaaagcctgtcaggactcctatcatcctcaacacg
ctggaaaacgaaaaagcaacagcgaccgtgacgttgaaggaaaattcattgaattccata
actcgtgaaacactccctgagaacactatggagattgcgcgtgaaaattaa

DBGET integrated database retrieval system