KEGG   Bartonella henselae Houston-1: BH15580
Entry
BH15580           CDS       T00180                                 

Gene name
trwL2
Definition
(GenBank) trwL2 protein
Organism
bhe  Bartonella henselae Houston-1
SSDB
Motif
Pfam: TrbC T4SS_pilin
Other DBs
NCBI-ProteinID: CAF28321
UniProt: Q6G1U3
Position
1804494..1804805
AA seq 103 aa
MKQLSNLRSKNNNRIVEIAAAMTVFFITCPAYAALDHAKKALDTLQNDLIKNIIPVAAAI
ILLCLAIGYAGRYIEKDTFIRWAIGVVIAGSATQLVTLLFTKQ
NT seq 312 nt   +upstreamnt  +downstreamnt
atgaaacaattaagtaatcttcgatcaaaaaataacaataggattgtagaaattgctgcg
gctatgactgtattctttataacttgtcctgcatatgccgcactagatcatgcaaaaaag
gctttagacaccttgcagaatgaccttattaaaaacatcattcctgttgcagctgctatc
atacttttgtgcttagcgattggttatgcaggccgctacatcgaaaaggatacatttata
cggtgggctattggcgttgttatcgctggatcagcaacccaacttgttaccttattattc
accaaacaataa

DBGET integrated database retrieval system