KEGG   Bartonella henselae Houston-1: BH15600Help
Entry
BH15600           CDS       T00180                                 

Gene name
trwL4
Definition
(GenBank) trwL4 protein
Organism
bhe  Bartonella henselae Houston-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC Peptidase_A8 DUF3852
Motif
Other DBs
NCBI-ProteinID: CAF28323
UniProt: A0A0R4J957
Position
1805190..1805507
Genome map
AA seq 105 aa AA seqDB search
MKRSNVLQSKINNDIFAIVAIMTVFLIVNPVYAQAQTLQKAENALTALQGQLKTIIPVAA
AVILLCLAIGYAGRYIEKDTFVRWGIGVVIAGSAAELVNVLFTTQ
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatcaaacgttcttcaatcaaaaatcaataatgacatcttcgcaattgttgcg
attatgactgtatttcttatagtgaatcctgtatatgctcaagcacaaactttacagaaa
gcagaaaacgctttaactgcgctccaaggtcaattgaaaacaattattcctgttgctgct
gctgtcatacttttgtgcttagcaattggttatgcaggacgttacatagaaaaagataca
ttcgtacggtggggaataggtgttgtcatagctggatcagcagctgaacttgttaatgta
ttattcacaacgcaataa

DBGET integrated database retrieval system