KEGG   Bartonella henselae Houston-1: BH15630Help
Entry
BH15630           CDS       T00180                                 

Gene name
trwL7
Definition
(GenBank) trwL7 protein
Organism
bhe  Bartonella henselae Houston-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC Peptidase_A8
Motif
Other DBs
NCBI-ProteinID: CAF28326
UniProt: A0A0H3M710
Position
1806567..1806881
Genome map
AA seq 104 aa AA seqDB search
MKQLNNLKSKINNKIIAIAAVMTVFFRGSPVYAQKNLENAKNALSSLHTELTGKIIPVAA
AVILLCLAIGYAGRYIEKDTFIRWAIGVVIAGSASELVALLFTT
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattaaataatctcaaatcaaaaattaacaacaagattatcgcaattgccgca
gttatgacggtgttttttaggggtagtcctgtatatgcccaaaaaaatttagaaaacgct
aaaaatgctttgagcagtctacacacagaacttacaggcaaaattattcctgttgctgct
gctgttatacttttgtgcttagcaattggctatgccgggcgctacatcgaaaaggatacg
tttatacggtgggctattggcgttgtcattgctggctcagcaagcgaacttgtcgcacta
ttgtttactacttaa

DBGET integrated database retrieval system