KEGG   Bartonella henselae Houston-1: BH15640Help
Entry
BH15640           CDS       T00180                                 

Gene name
trwL8
Definition
(GenBank) trwL8 protein
Organism
bhe  Bartonella henselae Houston-1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: CAF28327
UniProt: A0A0H3LYM7
Position
1807042..1807353
Genome map
AA seq 103 aa AA seqDB search
MESLNILRTKTVRKISFIFTALVVFLTTQPSCAQTTSKGLEILIGMQYGLGIIIPIFAAI
ILFFLLLIYMCRIISRITFARWAFSVIIAGAAFYISSILFYIN
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcttaaatattcttcgaacaaaaactgttagaaaaattagttttatttttaca
gctttggttgtgtttttaacgactcaacctagttgtgcccaaacaacaagcaaaggttta
gaaatcctcataggtatgcagtatgggttaggtatcattattcccatttttgctgccatc
attcttttctttctcctgcttatttatatgtgtcgcatcatctcaaggattacatttgcg
cgatgggcgtttagtgtcatcattgctggagcagcattttatattagcagcatattgttt
tacataaactaa

DBGET integrated database retrieval system