KEGG   Bartonella henselae Houston-1: BH15740
Entry
BH15740           CDS       T00180                                 

Gene name
trwF
Definition
(GenBank) trwF protein
  KO
K03204  type IV secretion system protein VirB9
Organism
bhe  Bartonella henselae Houston-1
Pathway
bhe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bhe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BH15740 (trwF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bhe02044]
    BH15740 (trwF)
Secretion system [BR:bhe02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   BH15740 (trwF)
SSDB
Motif
Pfam: CagX Bac_rhamnosid_N
Other DBs
NCBI-ProteinID: CAF28337
UniProt: A0A0R4J8X4
Position
1815148..1815954
AA seq 268 aa
MKKLAFMAFLSSFSFFYTVPVQALKTPSSSEYDHRIRYVTYNVADVVQIETVIGVATHII
LEEGERYITHAFGDSEAYAFAHKGRHIFIKPKAELANTNLIVVTDKRSYKFRLQFRNDRA
GATYELAFHYPDTNTQNLEENKQRLAIERGFHQSVNGYNLSYTMSGNQDIAPINAWDNGR
ITYFKFPANMDMPSIYLVDAEGNESLISRTVVGNSNDIIAVHKVNPKWLIRLGKRALAVF
NEAYDSNGIPNTTGTISSVVHRINKGGK
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaaaaaacttgcatttatggcctttttatcctcattttcctttttttatacggtaccc
gtgcaagcgctcaaaactccatctagttcagaatatgatcatcgcattcgctatgtaacg
tataatgtagctgatgtggttcagattgaaaccgttatcggtgtggcaacccatatcatt
cttgaagaaggtgagcgctatatcactcatgcatttggtgattctgaagcctatgccttt
gcacataaaggacgtcatatctttattaaacccaaagcagaacttgccaatacaaacctc
attgttgtaactgataagcgtagctacaaattccgactacagttccgtaatgaccgtgct
ggagcaacctacgaattagctttccattatccagatacaaacacccaaaatctagaagaa
aacaaacaacgccttgccattgaacgtggttttcatcaaagcgtaaatggttataacctt
agctacaccatgagcggcaaccaagatattgccccgataaacgcttgggacaatggacgt
attacctatttcaaatttccagccaacatggatatgccctcaatttacctagttgatgcc
gaaggcaatgaaagtttaatatcacgtactgttgtaggaaattcaaatgatatcatcgct
gttcataaggttaatcctaaatggctcatacgacttggcaaacgcgctttagctgttttc
aacgaagcctatgactccaatggtataccaaacacaactggaacaatatcctcggtggtt
caccgcatcaataaaggaggcaaatga

DBGET integrated database retrieval system