KEGG   Bacteroides heparinolyticus: C3V43_06810Help
Entry
C3V43_06810       CDS       T05405                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bhf  Bacteroides heparinolyticus
Pathway
bhf00480  Glutathione metabolism
bhf00590  Arachidonic acid metabolism
bhf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    C3V43_06810
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C3V43_06810
Enzymes [BR:bhf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     C3V43_06810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AVM57503
UniProt: A0A2R3MR95
Position
1640974..1641591
Genome map
AA seq 205 aa AA seqDB search
MKKKWLFMFAALLSLTASAQENIYGFKVKNAEEKEISLDAYKGKVLLIVNTATRCGFTPQ
YNELQAIYAKYREQGFDILDFPCNQFGEQAPGSNEEIHEFCTLNFNIQFEQFDKIEVNGD
AEIPLYTYLKKMQPFKGFDLNDKRGKFMDEMLKKKDARYAEKSDIKWNFTKFLVDAEGKV
VARFEPTASMEEVEKAIAALLPNKR
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaatggttatttatgtttgcggcacttttgtctctaaccgcatctgcacaa
gaaaacatttatggatttaaagtgaaaaacgccgaggagaaggaaatctctttagatgct
tacaaaggcaaggtcttgctgattgtcaatacggccacccgttgcggattcaccccgcag
tacaacgaacttcaagccatctatgccaaatatcgggagcagggattcgacattctcgat
tttccctgtaaccaattcggagagcaggcaccgggcagcaacgaagagatacacgagttt
tgcacgttgaacttcaacattcaatttgagcagttcgacaagatagaagtcaacggagac
gcggaaatccccttatatacttatttaaagaaaatgcaaccgttcaaaggtttcgactta
aatgacaagagaggaaagttcatggacgagatgctgaagaaaaaagatgcccgatatgcc
gaaaaatcggacatcaaatggaacttcaccaaattcttggtcgatgccgaagggaaagtc
gtggcacgttttgaacccacagcaagcatggaagaggtagagaaagcgattgcggcgctc
ctcccgaataagcgttga

DBGET integrated database retrieval system