KEGG   Bacillus horikoshii: B4U37_13975Help
Entry
B4U37_13975       CDS       T04904                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
bhk  Bacillus horikoshii
Pathway
bhk00350  Tyrosine metabolism
bhk00380  Tryptophan metabolism
bhk01100  Metabolic pathways
bhk01120  Microbial metabolism in diverse environments
bhk01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bhk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    B4U37_13975
   00380 Tryptophan metabolism
    B4U37_13975
Enzymes [BR:bhk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     B4U37_13975
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     B4U37_13975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: ART78636
UniProt: A0A1Y0CUM8
Position
complement(2694917..2696392)
Genome map
AA seq 491 aa AA seqDB search
MGIRTGEQYINSLRARKPEVWLGGRKVEDLYSEDVFKQPIHEIAKLYDMQFDPEYQDKIT
HMCEETGERVNNAFLVPRSHEDLMARSRLFETYARATFGLMGRTPDFLNVVVTSMASNSW
FLDKYNPDWSVNIRNYYRHIRDNDLFLTHAIINPQNDRSKASYEQKDLFTHLGTVKETKD
GLVVRGAKMLATLAPITDEVIIYSFPGFQPGDERYALAFAIPIDTPGLRIICREPMQDGK
RSVFDHPLASRYEEMDAILAFDDVSVPWDRVFMYNNVEAANSLYPMTGIAQQPAHQSGVR
GYVKLAFATEVACKVADSIGVDGFLNVQNDLGELVQAVETIRALLRVSEYEYEVTKDGEY
RPAPAPLETIRGLLPKMYPRAIEVMQIIGAGGLLMSPTGADFENTELRPDLDKYFGGREG
VSAEERVRIFKLAWDLCGEAFGQRLLQYERYYTGDPIRKRAIFYNQYKRKSKFEMAEQAL
KDTTKPEKNLI
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcaggacaggtgagcaatacattaactctttaagggccagaaagcctgaagtc
tggcttggtggtcggaaagtggaggatttatatagcgaagatgtgttcaagcagccaatt
catgaaattgccaaactttatgatatgcagtttgatcccgagtatcaggataagataacg
catatgtgtgaagaaacaggggaacgggtgaacaacgcgtttcttgtcccaagatctcac
gaagatcttatggcccgcagtagattgtttgagacttatgctcgtgcaactttcggcctt
atgggaagaacccccgatttcctgaatgtagtggtcacttccatggcaagcaactcttgg
tttttggataaatacaatccggattggtccgtgaatatacgaaattactaccgtcacatc
agggataatgatttatttttaacacatgcaatcattaatccacaaaatgatcgaagtaaa
gcttcctatgaacaaaaagatctgtttactcatttagggacggtaaaagaaacaaaggat
gggttagtggttagaggtgccaaaatgttggcaacattagctcctatcacagatgaggtg
attatctattctttcccgggattccaacctggtgatgagagatatgcgcttgcatttgcc
attcctattgataccccgggattacggattatttgccgtgaaccgatgcaggatggaaaa
cgttctgtattcgatcatccactggcttctaggtacgaagaaatggatgctattcttgcg
tttgacgatgtatcggtgccatgggacagagtatttatgtataacaatgtggaagcggcc
aattccttatatccaatgacaggaattgcccagcagcctgcccatcagtcaggagttaga
ggatatgtgaaactagcctttgcaacagaggtcgcatgtaaagtagcggattccatcgga
gtagatggatttttgaatgtgcaaaatgatcttggtgagctcgttcaagcagtggaaaca
attcgggcattactacgtgtatccgaatatgagtatgaagtgacaaaggatggagaatac
cgtccggcaccggcaccgcttgaaaccatcagaggtctactaccgaaaatgtacccacgg
gcaattgaagttatgcagattattggagcaggtggtttgctaatgtctcctacaggtgcc
gattttgaaaatacagaattacgaccggatttggacaagtattttggaggaagagaagga
gtgtcagcagaagaacgtgttcgcatatttaagcttgcatgggacctttgcggagaagct
ttcggacaacgcttattgcaatatgaacgctattatacaggggatccaatcagaaagaga
gcaattttttataatcaatacaagcgaaagagtaaattcgaaatggcagaacaagctctg
aaggatacaactaaaccagaaaaaaatctcatttaa

DBGET integrated database retrieval system