KEGG   Bacteroides helcogenes: Bache_0648Help
Entry
Bache_0648        CDS       T01393                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
bhl  Bacteroides helcogenes
Pathway
bhl00010  Glycolysis / Gluconeogenesis
bhl00052  Galactose metabolism
bhl01100  Metabolic pathways
bhl01110  Biosynthesis of secondary metabolites
bhl01120  Microbial metabolism in diverse environments
bhl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bhl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bache_0648
   00052 Galactose metabolism
    Bache_0648
Enzymes [BR:bhl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Bache_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADV42671
UniProt: E6SMV5
Position
complement(873959..875098)
Genome map
AA seq 379 aa AA seqDB search
MNYRLVTLLVGWVLLASACTSKQNVETTASGLAPANFQTEVDGKQTNLFVLKNKNGMEVC
ITNFGGRIVSVIVPDKNGVMKDVVLGFDSIRDYIKYPSDFGASIGRYANRINQGRITLDG
IEYQLPQNNYGHCLHGGPRGFQYQVFDARPLSDQALELTYLSKDGEEGFPGNLTCKVTFT
LTDDNAIDIRYSAETDRTTVVNMTNHSYFNLDGNPSGTNSDYLLTIDADSYTPVDSTFMT
TGEIASVEGTDMDFRQPVAVGARINNDFVQLKYGKGYDHNWVLNTRGDDSRPCATLESPL
TGIVLDVYTNEPGIQIYAGNFLDGTLTGKKGIVYNHRASVCLETQKYPDTPNKPEWPSAL
LKPGEKYDSHCIYKFSVKK
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaactacagattagtgactttattagtcgggtgggtgctattggcatcagcctgcaca
agcaagcagaatgtggaaacaactgcttcgggcttagcccctgctaacttccaaacagag
gttgatggcaagcaaacaaacttgtttgtactgaaaaacaaaaacggcatggaagtttgt
atcacaaacttcggcggacgtatcgtatcagtgatagtacccgataagaatggtgtgatg
aaagatgtggtattaggtttcgactctatccgggattacatcaaatatccttccgatttc
ggcgcatccatcggtcgttatgctaaccgtatcaatcaaggcaggattacgctcgacggt
atagaataccagttgcctcaaaataactatggtcattgcctgcatggtggtccccgtggc
tttcagtatcaggtctttgatgcacgtcctcttagcgatcaagctttggagttgacttat
ctttccaaagacggtgaagaaggtttcccgggcaatctgacttgtaaagtaacctttacc
ctgaccgatgacaatgccatcgacatccgctacagtgccgaaacagaccgcactaccgta
gtcaacatgactaatcattcttacttcaacctcgatggcaatccttcgggaactaactca
gactacctgcttaccattgatgccgactcttatacccctgtggacagcactttcatgact
accggtgaaatagcttccgtagaaggtactgatatggatttccgtcagcccgttgctgta
ggagcccgtatcaataatgactttgtgcagttgaagtacggtaagggatatgaccacaac
tgggtgcttaatacccgtggcgacgattcccgtccatgtgctacgctcgaatctcccctt
acaggcattgttctcgatgtttacactaacgaacctggtattcagatttatgccggtaac
ttcctcgacggtacgcttaccggaaagaaagggatcgtgtacaatcaccgtgcttctgta
tgtctcgaaactcagaagtatcccgatacccccaataaaccggagtggccgtcagcgttg
ctaaaaccgggagagaagtatgatagtcattgtatctataaattctcggtgaagaaataa

DBGET integrated database retrieval system