KEGG   Bacteroides helcogenes: Bache_2617
Entry
Bache_2617        CDS       T01393                                 

Definition
(GenBank) DEAD/DEAH box helicase domain protein
  KO
K05591  ATP-dependent RNA helicase DbpA [EC:3.6.4.13]
Organism
bhl  Bacteroides helcogenes
Brite
KEGG Orthology (KO) [BR:bhl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bhl03009]
    Bache_2617
Enzymes [BR:bhl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Bache_2617
Ribosome biogenesis [BR:bhl03009]
 Prokaryotic type
  rRNA helicases
   Bache_2617
SSDB
Motif
Pfam: DEAD Helicase_C DbpA ResIII UTP25
Other DBs
NCBI-ProteinID: ADV44573
UniProt: E6SVY4
Position
complement(3143681..3145081)
AA seq 466 aa
MTSSAAFLLDCYLFPIFASKSPKYMELSDILFNLKIERLTPMQKAASEAYRSNKDLVLLS
PTGSGKTLAFLLPLVQSLKPDVSGVQAVVLVPSRELALQIENVFKAMNTSFKAMCCYGGR
PAMDEHRTMRGICPAVIIGTPGRMNDHLKKENFDGNAVTTLVIDEFDKCLEFGFHDEMSE
VIGQLPSLKKRVLLSATDAEEIPQFAGVGNADSPQIAKLNFLSVEPVSERLNLQRVISPE
KDKLETLYRLLCVLGNHSTLVFVNYRESVERVAAYLKSKKFPCDAFHGGMEQADRERALY
KFRNGSCPVLISTDLAARGLDIPGIDNVVHYHLPVNEEAFTHRNGRTARWEARGFSFLIF
HSEEQLPDYVPETTPVFELPEVTPKPAKSRWATLYIGKGKKEKLNKTDIVGFLYKKGGLA
KEDVGQVDVKEHYAFVAVRQSKVKQLLALVRGEKIKGMKTIIEDAK
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgacatcatctgccgcctttttattggattgttatttatttcctatctttgcatccaaa
tcccctaaatatatggaattatcagatatccttttcaatttaaaaatagaacggcttacg
ccgatgcaaaaagccgcatcggaagcttatcgttcaaataaagatttggtattactttca
cctaccggttccggaaaaactctcgcttttctgttgccgttggtgcaatcattaaaacct
gacgtgtcgggagtacaagcggttgtgctggtcccttcccgtgagttagcattgcagata
gagaatgttttcaaagcgatgaatacctctttcaaagctatgtgctgctatggtggccgg
cctgcaatggacgaacatcggacgatgcgcggaatctgccctgccgtcattatcggtacg
ccggggcggatgaatgatcatttgaagaaagaaaatttcgatggcaatgccgtgactact
ttggttattgatgaatttgataaatgcctggagttcggctttcatgatgaaatgtcggaa
gttatcggacaattgccctcgttgaagaagcgcgtgttgctctctgctaccgatgctgaa
gaaattcctcagtttgccggagtaggcaatgcggatagccctcaaattgccaaattgaat
tttctttccgtagagcctgtctccgaacgtttgaacctgcaacgtgtcatttctcctgag
aaagataagttggaaactttatatcgcttgctatgcgtcttaggaaatcattccactctg
gtgtttgtcaattaccgtgaaagtgtggaacgggtggcggcatatttgaaatctaagaaa
tttccttgtgatgcatttcatggtggtatggagcaggcagaccgggagcgtgcgttgtat
aagttcagaaacggcagttgtccggttcttatatctactgatcttgctgctcgtgggctg
gacattcccggcattgacaatgtggtacattatcatcttcctgtcaacgaagaagctttc
acacatcgtaacggacggacggcacgttgggaagcacgcggcttttcttttctgattttt
cattctgaagagcagttgccggattatgttcctgaaactacccctgtctttgagttgccg
gaagtaacgcctaaaccggctaaatcccgttgggctaccttatatataggaaaggggaaa
aaggaaaaactgaataagacagacattgtgggttttctgtacaagaagggcggattggca
aaagaagatgtagggcaggttgacgtaaaagagcattatgcatttgtggctgtccgccaa
agcaaggtgaagcaacttctggcattggtacgtggtgaaaaaattaaaggaatgaagaca
ataatagaagatgctaaatag

DBGET integrated database retrieval system