KEGG   Bordetella holmesii 44057: D558_0518Help
Entry
D558_0518         CDS       T03379                                 

Definition
(GenBank) arginase family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bhm  Bordetella holmesii 44057
Pathway
bhm00220  Arginine biosynthesis
bhm00330  Arginine and proline metabolism
bhm01100  Metabolic pathways
bhm01110  Biosynthesis of secondary metabolites
bhm01130  Biosynthesis of antibiotics
bhm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    D558_0518
   00330 Arginine and proline metabolism
    D558_0518
Enzymes [BR:bhm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     D558_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AIT25207
Position
complement(496307..496759)
Genome map
AA seq 150 aa AA seqDB search
MIGAPTDVGASARGASMGPEALRVAGLTERLQRRGHRVHDSGNLAGPPNPWQPPVEGLRH
VDEVIAWNRLVHDAVYDALQCGHVPVMLGGDHCLAIGSISAVARHCRTAGQGLRVLWLDA
HTDFNTQVLTPTGNLHGMPVACLCGAGPGP
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggcgcgcccaccgatgtgggggccagcgctcggggcgcctccatggggcccgag
gccctgcgcgtggccggcctgacggaaaggctgcagcgccgcggtcaccgcgttcacgac
agcggcaacctcgccgggccgccgaatccatggcaaccgcccgtagagggcctgcgtcac
gtggacgaagtcatcgcctggaaccggctcgtgcatgacgccgtctatgacgcgctgcag
tgcgggcacgttccggtcatgctgggcggggaccattgtctggcgattggctcgatcagc
gccgtggcgcgccactgccgcaccgccgggcaaggcctgcgcgtgctctggctcgatgcg
cacactgatttcaacacccaggttctgacaccgacgggcaacctgcacggcatgcccgtg
gcctgtctgtgcggggccggccccggcccctga

DBGET integrated database retrieval system