KEGG   Bordetella holmesii 44057: D558_1493Help
Entry
D558_1493         CDS       T03379                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bhm  Bordetella holmesii 44057
Pathway
bhm00071  Fatty acid degradation
bhm00072  Synthesis and degradation of ketone bodies
bhm00280  Valine, leucine and isoleucine degradation
bhm00310  Lysine degradation
bhm00362  Benzoate degradation
bhm00380  Tryptophan metabolism
bhm00620  Pyruvate metabolism
bhm00630  Glyoxylate and dicarboxylate metabolism
bhm00640  Propanoate metabolism
bhm00650  Butanoate metabolism
bhm00900  Terpenoid backbone biosynthesis
bhm01100  Metabolic pathways
bhm01110  Biosynthesis of secondary metabolites
bhm01120  Microbial metabolism in diverse environments
bhm01130  Biosynthesis of antibiotics
bhm01200  Carbon metabolism
bhm01212  Fatty acid metabolism
bhm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bhm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    D558_1493
   00630 Glyoxylate and dicarboxylate metabolism
    D558_1493
   00640 Propanoate metabolism
    D558_1493
   00650 Butanoate metabolism
    D558_1493
  09103 Lipid metabolism
   00071 Fatty acid degradation
    D558_1493
   00072 Synthesis and degradation of ketone bodies
    D558_1493
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    D558_1493
   00310 Lysine degradation
    D558_1493
   00380 Tryptophan metabolism
    D558_1493
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    D558_1493
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D558_1493
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D558_1493
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bhm04147]
    D558_1493
Enzymes [BR:bhm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     D558_1493
Exosome [BR:bhm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D558_1493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT26167
Position
complement(1420858..1422039)
Genome map
AA seq 393 aa AA seqDB search
MSDPIVIVSVARTPMGGMMGSLSGLSAHELGAIAIKAAVERAGIKPDHVNEVIMGNVLQA
GQGQAPARQAALGAGLPLGVSCTTIHKVCGSGLKAAMFGHDLLLAGTADVVVAGGQESMS
NAPYLLLKGRQGYRYGHSTVYDHMALDGLEDAYDRGKAMGVFAEDCATKYSFSRQEQDEF
ALESLRRARAATEDGSFKWEITPVTVAGRKGDTEIDTDEAPTKAMPEKIPTLKPAFKKDG
TVTAANSSSISDGAAAMVLMRASTAQKLDVKPLARIVAHTQHSQEPQWFTTAPVGALKNL
FAKTGWKASDVDLYEINEAFAVVTMAAMKDFDLPHDKVNVHGGATALGHPIGASGARLMA
TLIGALRQKGGKKGVATLCIGGGEAVAMAIEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccctatcgtcatcgtttccgttgcccgtacgcccatgggcggcatgatgggc
agcctgtccggtctgtccgcccacgagctgggtgccatcgccatcaaggctgctgtcgag
cgcgccggcatcaagccggatcacgtcaatgaagtcatcatgggcaacgtgctgcaggcc
ggccagggccaggcgcccgcccgccaggccgcgctgggcgccggactgccgctgggcgtc
agctgcaccaccatccacaaagtctgcggttcgggcctgaaggcggccatgttcggccac
gacctgctgctggccggcaccgcggacgtggtggtcgccggtggccaggaaagcatgagc
aacgccccctatctgctgctcaagggccgccagggttaccgctacggtcacagcaccgtc
tacgaccacatggccctcgacggcctggaagacgcctacgaccgcggcaaggccatgggt
gtattcgccgaagactgcgccaccaagtacagcttcagccgccaggaacaggatgaattc
gcgctggagtcgctgcgtcgcgcccgcgcggccaccgaagacggcagcttcaaatgggaa
atcactcccgtgaccgtggccggccgcaagggcgacacggagatcgacaccgacgaagcg
ccaaccaaggccatgccggagaagatcccgaccctcaagccggccttcaagaaagacggc
acggtgacagccgccaactcgtcgtcgatttccgatggcgccgccgccatggttctgatg
cgcgcctcgaccgcgcaaaagcttgacgtcaagccgctggcgcgcatcgtggcccacacc
cagcactcgcaagagccgcaatggttcaccacggctccggtgggcgcactgaaaaacctg
ttcgccaagaccggctggaaagccagcgatgtagatctgtacgagatcaacgaagcattt
gccgtggtcaccatggccgccatgaaggatttcgatctgccgcatgacaaggtcaacgtc
cacggcggcgccacggcgctgggccaccccatcggcgcatctggcgcccgtctgatggcc
acccttatcggcgcgttgcgtcagaagggcggcaaaaaaggcgtggccacgctgtgcatc
ggcggcggtgaagccgtcgccatggccatagaaatgctctga

DBGET integrated database retrieval system