KEGG   Bordetella holmesii 44057: D558_1711Help
Entry
D558_1711         CDS       T03379                                 

Gene name
selD
Definition
(GenBank) selenide, water dikinase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
bhm  Bordetella holmesii 44057
Pathway
bhm00450  Selenocompound metabolism
bhm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bhm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    D558_1711 (selD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bhm03016]
    D558_1711 (selD)
Enzymes [BR:bhm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     D558_1711 (selD)
Transfer RNA biogenesis [BR:bhm03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    D558_1711 (selD)
 Prokaryotic Type
    D558_1711 (selD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: AIT26382
Position
1617903..1618952
Genome map
AA seq 349 aa AA seqDB search
MSTDTVPRLTSLSHGGGCGCKIAPGVLSELLARFVPQRNDPNLLVGTETSDDAAVYRLND
QQALIATTDFFMPIVDNPFDFGRIAATNALSDIYAMGGTPIMALAIVGMPINVLPHGVIA
DILRGGESVCQEAGIMIAGGHSIDSVEPIYGLAAMGLVHPDRIKRNADARAGDVLILGKP
LGVGVLSAALKKNLLDEVGYAAMIAATTQLNRPGPDLGALPGVHAITDVTGFGLLGHALE
MVRGAGLTARLRLADLPWMPGVRALAANGVVTGASGRNWASYGGSVHLGSSITDSDRALL
TDPQTSGGLLVSCAPSAAARVLEVFAAGGFAQAAIIGEMAAGEGRVEVV
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgataccgtcccgcgcctgacgtcgctgtctcatggcggcggctgcggctgc
aaaatcgcgccaggtgtgttgtcagagctgttggcgcgtttcgtcccgcagcgcaacgac
ccgaatctgttggtgggcaccgagacttccgacgacgctgcggtctatcgcctcaacgat
cagcaggccttgatcgccaccaccgatttcttcatgcccatcgtcgacaatcccttcgac
ttcgggcgaatcgccgcgaccaatgcgctgtcggacatctatgccatgggcggcacaccc
atcatggcgctggccattgtgggcatgcccatcaatgtcttgccgcatggggtgatcgcc
gacatcctgcgcggcggcgaatccgtctgccaggaggccggcatcatgatcgcaggcggg
cacagcatcgactcggtcgaacccatctatggcctggccgccatgggcctggtgcatccg
gaccgcatcaagcgcaatgccgatgcacgcgctggcgacgtactcatcctgggcaaaccc
ctgggcgtcggtgtgctgtctgccgcgctgaagaaaaaccttctggacgaagtcggttat
gccgccatgatcgcggcgaccacccagctcaatcgtccgggtcccgatctgggcgcactg
cccggcgtgcatgccattaccgatgtcaccggctttggtttgttgggtcatgcactggag
atggttcgcggcgctgggctgaccgccagactgcgactcgcggatctgccctggatgccg
ggcgtacgcgccctggccgccaatggcgtggtgacgggcgcctccgggcgcaactgggcc
tcctacggcggctcggtgcatcttggttccagtatcactgacagcgatcgggcgttgttg
acggatccacagacatcgggcggtctgttggtgtcgtgcgcgccgtctgcggccgctcgg
gtgctggaggtcttcgcggccggcggatttgcccaggctgcgatcatcggtgagatggcc
gccggcgagggccgggtcgaggtggtctaa

DBGET integrated database retrieval system