KEGG   Bordetella holmesii 44057: D558_2332Help
Entry
D558_2332         CDS       T03379                                 

Definition
(GenBank) degT/DnrJ/EryC1/StrS aminotransferase family protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bhm  Bordetella holmesii 44057
Pathway
bhm00260  Glycine, serine and threonine metabolism
bhm01100  Metabolic pathways
bhm01110  Biosynthesis of secondary metabolites
bhm01120  Microbial metabolism in diverse environments
bhm01130  Biosynthesis of antibiotics
bhm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bhm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D558_2332
Enzymes [BR:bhm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     D558_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase DegT_DnrJ_EryC1 HEM4
Motif
Other DBs
NCBI-ProteinID: AIT26993
Position
2195609..2195998
Genome map
AA seq 129 aa AA seqDB search
MGSQALIEQARRWRKVLGGGMRQSGVLAAAAQYALEHNVARLAQDHEHASLLGQGLAQLP
GVQVLSQSTNMVFVSVAPEHRSRLNQGLKEAGILMSAVYDGPVRLVTHLDISRQDIERAL
QVFARLLSA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagccaggcgctgatcgagcaggccaggcgttggcgcaaggtgctcggcggtggt
atgcgccagtcaggggtcttggccgcagcggcgcagtacgcacttgaacacaatgtggcg
cgtctggcccaagaccacgagcacgcgagcctgttgggccaggggctggcgcaattgcct
ggcgtgcaggtgctgtcgcagagcaccaatatggtgttcgtgagtgttgctcccgaacac
cgcagcaggctcaaccaaggcctgaaggaagcgggcattctgatgagcgcggtctatgac
gggccggtacgtctggtgacccatctcgatatttcccgccaggacatcgagcgcgcactg
caggtgtttgcccgcttgttgagcgcatga

DBGET integrated database retrieval system