KEGG   Bartonella henselae BM1374163: PRJBM_01014Help
Entry
PRJBM_01014       CDS       T03068                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bhn  Bartonella henselae BM1374163
Pathway
bhn03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bhn00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PRJBM_01014 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bhn03011]
    PRJBM_01014 (rplV)
Ribosome [BR:bhn03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PRJBM_01014 (rplV)
  Bacteria
    PRJBM_01014 (rplV)
  Archaea
    PRJBM_01014 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ph1570
Motif
Other DBs
NCBI-ProteinID: CDO40388
UniProt: X5M430
Position
complement(1138501..1138890)
Genome map
AA seq 129 aa AA seqDB search
MGKAKFPRQLKDNEAKAVARTIRVSPQKLNLVAAMIRGKKVGAALADLTFSRKRIAGTVK
KTLESAVANAENNHDLDIDSLVVAEAYVGKSIVMKRFHVRGRGRASRIERPFSHLTIIVR
EVIEKVEVA
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagctaagtttccgcgccagcttaaagataatgaggcgaaagctgtggctcgg
acaattcgtgttagtccgcaaaaacttaatttggttgctgcgatgattcgtggtaaaaaa
gttggtgctgcactggctgatttaacattttcacgtaaacgtattgctgggacggtgaaa
aaaactcttgaatcagcggttgcaaatgcagagaataatcatgatcttgatattgattcg
cttgttgtcgcagaagcttatgttggtaagtcgatagtaatgaagcgttttcatgttcgt
ggtcgtgggcgcgctagtcgcattgaacgtccattttcgcatcttactattattgttcgt
gaagttatcgaaaaagtggaggtcgcataa

DBGET integrated database retrieval system