KEGG   Bordetella holmesii ATCC 51541: D560_0530Help
Entry
D560_0530         CDS       T03052                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00220  Arginine biosynthesis
bho00330  Arginine and proline metabolism
bho01100  Metabolic pathways
bho01110  Biosynthesis of secondary metabolites
bho01130  Biosynthesis of antibiotics
bho01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    D560_0530 (rocF)
   00330 Arginine and proline metabolism
    D560_0530 (rocF)
Enzymes [BR:bho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     D560_0530 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AHV91616
Position
complement(495692..496594)
Genome map
AA seq 300 aa AA seqDB search
MIGAPTDVGASARGASMGPEALRVAGLTERLQRRGHRVHDSGNLAGPPNPWQPPVEGLRH
VDEVIAWNRLVHDAVYDALQCGHVPVMLGGDHCLAIGSISAVARHCRTAGQGLRVLWLDA
HTDFNTQVLTPTGNLHGMPVACLCGAGPRPLTQLSGASPALQPAWIRQVGIRSVDEGERC
LVRQAGLQVYDMRHIDEAGMRATMQAALAGLDDDMHLHVSFDVDFLDPDVAPGVGTTVPG
GATYREAQLCMEMIADTGRMASLDIVELNPALDVRNKTAIVAAELVESLFGKSTLIRPQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
ttgatcggcgcgcccaccgatgtgggggccagcgctcggggcgcctccatggggcccgag
gccctgcgcgtggccggcctgacggaaaggctgcagcgccgcggtcaccgcgttcacgac
agcggcaacctcgccgggccgccgaatccatggcaaccgcccgtagagggcctgcgtcac
gtggacgaagtcatcgcctggaaccggctcgtgcatgacgccgtctatgacgcgctgcag
tgcgggcacgttccggtcatgctgggcggggaccattgtctggcgattggctcgatcagc
gccgtggcgcgccactgccgcaccgccgggcaaggcctgcgcgtgctctggctcgatgcg
cacactgatttcaacacccaggttctgacaccgacgggcaacctgcacggcatgcccgtg
gcctgtctgtgcggggccggcccccggcccctgacccagttgtctggcgccagccctgct
ctgcaacccgcctggatcaggcaggtaggaatacgcagcgtggacgagggcgagcgctgc
ctggtccggcaggcggggctgcaggtttatgacatgcgtcatatcgacgaggcagggatg
cgcgccaccatgcaggcggcgctggcaggcctggatgacgacatgcatttgcatgttagt
ttcgacgtggattttctggatccggacgtcgcgccgggtgtcggcaccacggtgcctggc
ggcgcgacctatcgtgaggcccagctatgcatggagatgatcgccgataccgggcgcatg
gcatcgctggacattgtcgaactcaaccccgcgctggatgtgcgcaataaaacggccatc
gtcgccgccgaattggtcgagagcctgttcggcaaatcgacgctgatccggcctcagggg
tag

DBGET integrated database retrieval system