KEGG   Bordetella holmesii ATCC 51541: D560_1006Help
Entry
D560_1006         CDS       T03052                                 

Gene name
amiC
Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase AmiC
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:bho00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    D560_1006 (amiC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bho01011]
    D560_1006 (amiC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bho03036]
    D560_1006 (amiC)
Enzymes [BR:bho01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     D560_1006 (amiC)
Peptidoglycan biosynthesis and degradation proteins [BR:bho01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   D560_1006 (amiC)
Chromosome and associated proteins [BR:bho03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    D560_1006 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN Spherulin4
Motif
Other DBs
NCBI-ProteinID: AHV93874
Position
949790..951070
Genome map
AA seq 426 aa AA seqDB search
MPVLPRLAHAATILAVRTWPAEEYTRVTLELDRELKAEQFTLENPHRLVVDIEGLTTNAA
LNDLVAKVRPGDPYIQGLRVAQNRPNVVRLVFDLKQAVAPQVFTLKPVGDYQYRLVLDLY
PKIAQDPLVAVLNKSASPDVDDPLARVLDEISRNQPTPAPAPLARGQEPAAALPVPTPKP
ATPAPGRTRRRMLTIALDPGHGGEDPGAIGATGLREKDVVLRIARRLKTLIDAQPAMRAY
LTRDDDYFVPLHVRVQKARRVRADLFISIHADAWVKPSANGSSVFALSERGASSTQARWM
ADKENAADLIGGVNLGSHDRQVAKVLLDLSTTAQINDSLKVGTAFLDEIKKINRLHKNHV
EQAGFAVLKAPDIPSILVETAFISNPEEESKLRSNAHLDKLAQAMLTGIDRYFTANPPLA
RMADVS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
ttgccggtccttccacggctggcacatgcggccaccatcctggccgttcgcacctggccg
gccgaagagtacacacgcgtgacgctggagctcgaccgcgagctcaaggccgagcaattc
accctcgaaaatccgcaccgcctggtggtcgacatcgaaggcttgacgaccaacgccgcg
ctgaacgatctggtggccaaggtacggccgggcgatccctacatccagggcctgcgcgtg
gcgcagaatcgccccaacgtcgtgcgcctggtattcgatctgaagcaggccgtcgcgccg
caggtcttcacgctcaagcccgtgggcgattatcaataccgcctggtgctcgacctctat
cccaagattgcccaggatccgctggtcgccgtcctgaacaaatcggccagcccggatgtc
gacgacccgctggcccgcgtgcttgacgagatttcgcgcaatcagcccacgcccgctccc
gccccgctggcgcgcggccaggagcccgcggcggcactgccagtgcccacgcccaaaccg
gcgacacccgcaccgggtcggacgcgccgtcgcatgctcaccatcgcgctggatcccggc
cacggcggcgaagacccgggagccatcggcgccacgggcttgcgcgaaaaagacgtggtg
ctgcgcatcgcacgccgcctcaagaccctgatcgatgcacagcctgccatgcgggcctat
ctgacacgcgacgacgactacttcgtgccgctgcatgtgcgggtgcaaaaagcgcgtcgt
gtgcgtgccgacctgttcatctccattcatgccgacgcctgggtcaaaccgtcggccaat
ggttcctcggtgtttgcgctgtccgagcgcggcgcatccagcacgcaggcgcgctggatg
gccgacaaagaaaacgcggccgacctgatcggcggcgtcaacctcggcagccacgaccgt
caggtcgccaaggtgctgttggatctgtcgaccaccgcgcagatcaatgattcgctcaag
gtaggcacggcctttctcgatgagataaaaaagatcaaccgcctgcacaagaaccatgtc
gaacaggccggtttcgcggtgctcaaggcgccggacattccatccatcctggtcgaaacg
gccttcatcagcaaccctgaagaagaatccaagctgcgcagcaatgcgcacctggacaag
ctggcccaggccatgctgaccggcatagatcgctacttcacggccaacccgccgctggcc
cgcatggcggatgtcagctga

DBGET integrated database retrieval system