KEGG   Bordetella holmesii ATCC 51541: D560_1030Help
Entry
D560_1030         CDS       T03052                                 

Gene name
glyQ
Definition
(GenBank) glycine--tRNA ligase, alpha subunit
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bho00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    D560_1030 (glyQ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bho01007]
    D560_1030 (glyQ)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bho03016]
    D560_1030 (glyQ)
Enzymes [BR:bho01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     D560_1030 (glyQ)
Amino acid related enzymes [BR:bho01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   D560_1030 (glyQ)
Transfer RNA biogenesis [BR:bho03016]
 Prokaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    D560_1030 (glyQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: AHV93206
Position
973787..974698
Genome map
AA seq 303 aa AA seqDB search
MLTFQQIILTLQEYWDKQGCALLQPYDMEVGAGTSHTATFLRAIGPEPWRAAYVQPSRRP
KDGRYGENPNRLQHYYQYQVVLKPAPPEILDLYIGSLKALGINPAEHDIRFVEDDWENPT
LGAWGLGWEVWLNGMEVTQFTYFQQVGGLDCTPTTGEITYGLERLAMYLQGVESVYDLVW
TEGANGRRVLYRDVFHQNEVEQSTYNFEHSSAEMLFAHFNDYEAEAKRLMDVPLALPAYE
AALKAAHTFNMLDARGAISVTERAAYIGRIRNLSRAVAQAYYDSRERLGFPMLGGSAPAG
EAA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcttacctttcagcaaatcatcctcacgctccaggagtactgggacaaacaaggttgc
gccctgctgcagccctatgacatggaagtcggcgccggtacctcgcacacggcgaccttt
ctgcgcgccatcgggccggaaccctggcgcgccgcctatgtccagccctcgcgccgcccc
aaggatggccgctacggcgaaaatcccaaccgcctccagcactactaccagtatcaggtc
gtgctcaagccggcgccgcctgaaatcctggatctctacatcggttcgctcaaggccctg
ggcatcaatccggccgagcacgacatccgtttcgtcgaggatgactgggaaaatcccacg
ctgggcgcctggggcctgggctgggaagtctggctcaatggcatggaagtcacccaattc
acctattttcagcaggtcggcgggctggactgcacgcccacgaccggcgagatcacctat
ggcctggagcgtctggccatgtatctgcaaggtgtcgaaagcgtatacgacctggtctgg
acggaaggcgccaatggccgccgcgtgctgtaccgcgacgtgttccaccagaacgaggtc
gagcaatccacctacaacttcgagcactcctcggccgagatgctgttcgcacatttcaac
gattacgaagccgaggccaaacgcctgatggacgtgccgctggccctgccggcctacgag
gccgcgctgaaagccgcccacaccttcaacatgctcgatgcgcgtggcgccatcagcgtg
accgagcgtgccgcctatatcggccgcatccgcaacctgtcgcgcgccgtcgcgcaggcc
tactacgactcccgtgaacgactgggctttcccatgctgggcggcagcgcccccgccggg
gaggctgcctga

DBGET integrated database retrieval system