KEGG   Bordetella holmesii ATCC 51541: D560_1086Help
Entry
D560_1086         CDS       T03052                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00290  Valine, leucine and isoleucine biosynthesis
bho00770  Pantothenate and CoA biosynthesis
bho01100  Metabolic pathways
bho01110  Biosynthesis of secondary metabolites
bho01210  2-Oxocarboxylic acid metabolism
bho01230  Biosynthesis of amino acids
Module
bho_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bho_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    D560_1086 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    D560_1086 (ilvD)
Enzymes [BR:bho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     D560_1086 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AHV91785
Position
1024627..1026441
Genome map
AA seq 604 aa AA seqDB search
MAGARALWRATGMKDGDFGKPIIAVVNSFTQFVPGHVHLKDLGALVAGQIEAAGGVAKEF
NTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCISNCDKITPGMLMAAM
RLNIPVVFVSGGPMEAGKVTSPTDGKIIKLDLVDAMIKAADPNVSDAEAEQVERSACPTC
GSCSGMFTANSMNCLTEAIGLALPGNGTIVATHAWRRGLFEQAGRLVVDLCRRYYEQEDS
SVLPRSIATKAAFENAMALDVAMGGSTNTVLHLLAAAQEAGVDFTMADIDRISRKVPCLC
KAAPATDKYHIEDVHRAGGILGILGELGRADLLDLSCGNVHSGTLGNAIAQWDVAGGAGD
AARKFYRAAPGGVPTTVAFSQEKTFLTLDVDRQAGCIRSKEHAYSKDGGLAVLYGNLAEK
GCIVKTAGVDESQWVFTGRARVYESQEDAVEGILGDKVVDGDVVIIRYEGPKGGPGMQEM
LYPTSYLKSKGLGKTCALFTDGRFSGGSSGLVIGHASPEAAEGGTIGLVEDGDIIEIDIP
QRRMHLAVEDAELARRRAVMEARGEQAWKPVDRERVVSLALQAYAALATSADRGAVRDLS
QLKR
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcgcgcgcactctggcgcgccaccggcatgaaggacggcgatttcggcaag
cccatcatcgcagtggtcaactcgttcacgcagttcgtgcccggccacgtgcacctgaag
gatctgggtgcgctggtggcaggccagatcgaagccgccggcggcgtggccaaagaattc
aataccatcgccgtggacgacggcatcgccatggggcacggcggcatgctgtattcgttg
ccgtcgcgcgagctgatcgccgactcggttgaatacatggtcaatgcccattgcgccgat
gccatggtctgcatctccaactgtgacaagatcacgccggggatgctgatggctgccatg
cgcttgaacatccccgtggtgtttgtttccggtggcccgatggaggctggcaaggtgacc
tcgcccaccgacggcaagatcatcaagctcgatctggtcgacgccatgatcaaggccgcc
gatcccaacgtaagcgacgccgaagccgagcaggtcgaacgcagcgcctgcccgacgtgc
ggctcctgttccggcatgttcactgccaactccatgaactgtctgaccgaggccatcggc
ctggcgctgccgggcaacggcaccatcgtggccacgcacgcctggcgccgggggctgttc
gagcaggctggccgcctggtggtggacctgtgccgccgttactacgaacaggaagacagc
tcggtgctgccgcgcagcattgccaccaaggccgcctttgagaacgccatggcgctggat
gtggccatgggcgggtcgaccaacacggtgttgcatttgttggccgccgcccaggaagcc
ggggtggacttcaccatggctgacatcgaccgcatttcgcgcaaggtgccctgcttgtgc
aaagccgcaccggcgaccgacaagtaccacatcgaagacgtgcatcgcgccggcggcatc
ctgggcatcctgggtgagttgggccgagccgatctgctggatctgagctgcggcaatgtg
cacagcggcacgctgggcaatgcgatcgcgcaatgggacgtggcgggcggcgcaggcgat
gcggcccggaagttttaccgcgcggcccctggcggcgtgccgaccacggtagcgttcagc
caggagaaaaccttcctgaccctggatgtcgatcgtcaggcaggctgcatccgcagcaaa
gagcacgcttactccaaggatggcggcctggccgtgctttacggcaacctggccgagaag
ggctgcatcgtcaagactgccggcgtggacgagtcgcaatgggtgtttaccggccgggcg
cgcgtctatgagagccaggaagacgccgtcgagggcattctgggcgacaaggtcgtcgat
ggcgacgtggtcatcattcgctacgaaggccccaagggcggccccggcatgcaggaaatg
ctctacccgacctcttacctgaagtccaagggcctgggtaaaacgtgcgcgctctttacc
gacgggcgtttttcgggcggctcgtccggcctggtgattggccacgcgtcgcccgaagcg
gccgaaggcggcaccatcgggctggtcgaggatggtgacatcatcgaaatcgacattccg
caacgccggatgcacctggcggtcgaggatgccgaactggcgcgccgccgtgccgtgatg
gaggctcgcggcgagcaggcatggaaaccggtcgaccgcgagcgtgtggtgtcgctggcc
ttgcaggcctacgccgcgctggccacctcggctgaccggggcgccgtgcgcgatctgtct
cagctcaagcgctga

DBGET integrated database retrieval system