KEGG   Bordetella holmesii ATCC 51541: D560_1089Help
Entry
D560_1089         CDS       T03052                                 

Definition
(GenBank) D-galactarate dehydratase/altronate hydrolase family protein
  KO
K01685  altronate hydrolase [EC:4.2.1.7]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00040  Pentose and glucuronate interconversions
bho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    D560_1089
Enzymes [BR:bho01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.7  altronate dehydratase
     D560_1089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GD_AH_C SAF
Motif
Other DBs
NCBI-ProteinID: AHV92397
Position
1028839..1029516
Genome map
AA seq 225 aa AA seqDB search
MGLGEALEGGLYRSRSQAPAGYKIASRDIRAGEPIRKYNVIIGFAAQDIPQGTMVHSHNV
EFREFDRDYAHARDYKPTDFVAEENRATFEGIVRANGDVGTRNYIGLLSTVNCSATVIRK
AAEWFTPERLAGYPNVDGVVAFSHAIGCGMEMTGEPMALLRRTITGYARHPNLAAVLIVG
LGCERNQISGLMEQESLTSGSRLKTFVMQETGGTRKTIEACIAEI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
gtggggctgggcgaagcgcttgaaggcggcctttaccggtcgcgcagtcaggcgccagcc
ggctacaagattgcttcacgagatatcagggcaggtgagccgatccgaaagtacaacgtg
atcatcggctttgcggcgcaagatatccctcagggcacaatggtccacagccacaacgtc
gagtttcgggaattcgaccgtgactatgcgcacgctcgcgattataagccgactgacttc
gtcgccgaggagaaccgggccactttcgaaggcatcgtccgcgccaacggggacgtcggc
acgcgcaattacattggcctgctgtcaaccgtgaactgttccgcaacggtcattcggaag
gcagcagaatggtttacgcctgagcgcctggccggctatccaaacgtcgatggcgtcgtg
gcgttcagccatgctatcgggtgcggcatggaaatgaccggcgagcctatggcactgctt
cgccgtacgatcaccggctatgcgcggcatccgaacctcgcggcggtgctgattgtcggc
ctggggtgcgagcggaaccagatttcgggcctgatggaacaggagagcttgacttccggt
tcgcgcttgaagacgttcgttatgcaggagacgggcggcacgcgcaaaacgatcgaggcc
tgtattgctgaaatttag

DBGET integrated database retrieval system