KEGG   Bordetella holmesii ATCC 51541: D560_1092Help
Entry
D560_1092         CDS       T03052                                 

Gene name
tam
Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
bho  Bordetella holmesii ATCC 51541
Brite
KEGG Orthology (KO) [BR:bho00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D560_1092 (tam)
Enzymes [BR:bho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     D560_1092 (tam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS FtsJ NodS Methyltransf_2 PCMT Methyltransf_32 Methyltransf_4 Ubie_methyltran MetW
Motif
Other DBs
NCBI-ProteinID: AHV92709
Position
complement(1031408..1032175)
Genome map
AA seq 255 aa AA seqDB search
MSWSAKQYSAFENERTRPVRDLVAAIPDAEVRHAVDLGCGPGNSTQVLADRYPQAKVSGM
DSSPDMVAAARKRLPGLAFSQADISSWRPADRYDVILANASLQWVPDHATLYPRLLQTLT
PGGSLAVQTPDNLEEPAHRLARAVAAEQPWAAKLAGVRHPDRHSAEWYYALLSPLAQRVD
VWRTTYMHPLAGARAIVEWFKGTALLPYLNVLDDNEQAAFLARYEAAIAQAYPALPDGTV
LLPFPRLFVVASRKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagttggtccgccaagcagtactccgctttcgagaatgagcgtacgcgtccggtgcgg
gatctcgtggcagccatccccgatgccgaggtccggcatgcggtcgatctcggttgcggc
ccgggcaattcgacccaagtgctggcggaccgttatccgcaggccaaggtcagcggcatg
gacagttcgccagacatggttgccgcagcccgcaagcgtttgcccggactggcgttcagc
caggcagatatttccagctggcgtcccgccgatcgttacgatgtcattttggccaacgct
tctctgcaatgggtgcccgaccacgcgacactctatccacggctgctgcagacgctgaca
ccgggcggcagcctggccgtccagacaccagacaacctggaagagccggcgcatcgtctg
gcgcgggcggtggccgccgagcagccctgggccgccaagctggcaggcgtgcgtcacccc
gacaggcacagcgcggaatggtattacgccctgctctcgcccctggcccagcgcgtggat
gtgtggcgtaccacctatatgcatccgctggccggcgcgcgcgccatcgtcgagtggttc
aagggcacggcgttgctgccctacctgaatgtgctggatgacaacgagcaggcggcgttt
ctggcacgctacgaagccgcgattgcccaggcgtatccggcgctgcccgatggcaccgtg
ctgctgccgtttccgcgcctgttcgtggtggcttcccgcaaggcctga

DBGET integrated database retrieval system