KEGG   Bordetella holmesii ATCC 51541: D560_1102Help
Entry
D560_1102         CDS       T03052                                 

Definition
(GenBank) polyprenyl P-hydroxybenzoate and phenylacrylic acid decarboxylase family protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
bho  Bordetella holmesii ATCC 51541
Pathway
bho00130  Ubiquinone and other terpenoid-quinone biosynthesis
bho00627  Aminobenzoate degradation
bho01100  Metabolic pathways
bho01110  Biosynthesis of secondary metabolites
bho01120  Microbial metabolism in diverse environments
bho01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    D560_1102
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    D560_1102
Enzymes [BR:bho01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     D560_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AHV91772
Position
complement(1041620..1042186)
Genome map
AA seq 188 aa AA seqDB search
MRRLVVGITGATGALYAVRMLQVLRGVEDVETHLVVSASGVLNIQHELDIGRHEVQALAD
HSHGVRDVGATLASGAFATAGMVIVPCSMRTLAAVAHGLSDNLITRAADVTLKERRRLVM
MVRETPFNLAHLRNMTAVTEMGGIIFPPLPAFYHRPASTEEMIDHTVARVLDLFDIKVPG
PSWDGTRA
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgtctggtcgttggcatcaccggcgccacgggcgccctttatgccgtgcgcatg
ttgcaagttctgcgcggcgtcgaggatgtggaaacgcatctggtggtgtcggcctccggt
gtactcaatatccagcatgagttggatattgggcgccatgaggtacaggccctggctgat
catagccacggtgtgcgggatgtcggcgcaacgctggccagcggcgcgttcgctacggcc
ggcatggtcatcgttccctgctccatgcgcacgttggccgcggtcgcgcacggcctgtcc
gataacttgatcacacgcgcggcggatgtgacgctcaaggagcgccgccgtctggtgatg
atggtgcgcgagacgccattcaatctggcgcatctgcgcaatatgaccgccgtcacggaa
atgggcggcattatctttccgccgctgccggccttctatcatcggccggcaagcaccgaa
gagatgatcgatcacacggtcgcccgcgtgctcgatctcttcgacatcaaggtgcccggc
ccaagctgggacggcacgcgggcctga

DBGET integrated database retrieval system